(data stored in ACNUC7421 zone)

EMBL: CP001658.PE187

CP001658.PE187       Location/Qualifiers
FT   CDS             complement(210831..212189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00181"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00181"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23208"
FT                   /protein_id="ACT23208.1"
FT                   /translation="MSQAQPRPAAPNPKRNVKAIRTVRFWMAPIATTLALMSALAALYL
FT                   GGILNPMTNLRHFPIALVNEDAGPAGQQIVDGLVSGLDKNKFDIRVVSPDEARRLLDTA
FT                   AVYGSALIPPTFSSQLRDFGASAVTPTRTDRPAITISTNPRAGTLAASIAGQTLTRALT
FT                   VVNGKVGERLTAEVAAQTGGVALAGAAAAGLASPIDVKSTAYNPLPNGTGNGLSAFYYA
FT                   LLLLLAGFTGSIVVSTLVDSMLGYVPAEFGPVYRFAEQVNISRFRTLLVKWAVMVVLAL
FT                   LTSGVYLAIAHGLGMPIPLGWQVWLYGVFAIIAVGVTSSSLIAVLGSMGLLVSMLIFVI
FT                   LGLPSAGATVPLEAVPAFFRWLAQFEPMHQVFLGVRSLLYLNGNADAGLSQALTMTSIG
FT                   LIIGLLLGGFITHLYDRSSFHRIPGAVEMAIAVEHQAQYQARQSARESSSEQP"
     MSQAQPRPAA PNPKRNVKAI RTVRFWMAPI ATTLALMSAL AALYLGGILN PMTNLRHFPI        60
     ALVNEDAGPA GQQIVDGLVS GLDKNKFDIR VVSPDEARRL LDTAAVYGSA LIPPTFSSQL       120
     RDFGASAVTP TRTDRPAITI STNPRAGTLA ASIAGQTLTR ALTVVNGKVG ERLTAEVAAQ       180
     TGGVALAGAA AAGLASPIDV KSTAYNPLPN GTGNGLSAFY YALLLLLAGF TGSIVVSTLV       240
     DSMLGYVPAE FGPVYRFAEQ VNISRFRTLL VKWAVMVVLA LLTSGVYLAI AHGLGMPIPL       300
     GWQVWLYGVF AIIAVGVTSS SLIAVLGSMG LLVSMLIFVI LGLPSAGATV PLEAVPAFFR       360
     WLAQFEPMHQ VFLGVRSLLY LNGNADAGLS QALTMTSIGL IIGLLLGGFI THLYDRSSFH       420
     RIPGAVEMAI AVEHQAQYQA RQSARESSSE QP                                     452
//

If you have problems or comments...

PBIL Back to PBIL home page