(data stored in ACNUC7421 zone)

EMBL: CP001658.PE192

CP001658.PE192       Location/Qualifiers
FT   CDS             215654..216163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00186"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00186"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23213"
FT                   /protein_id="ACT23213.1"
FT                   /translation="MIGADVPRDSQRARVYAAEAFVRTLFDRVTAHGSPTVEFFGTQLT
FT                   LPPEGRFGSVASVQRYVDDVLALPAVGQNWPTVSPVRVRARRAATAAHYENHGGTGTIA
FT                   VPDRHTAGWAMRELVVLHEVAHHLCQVPPPHGPEFVATVCTLTELVMGPEVGHVFRVVY
FT                   AQEGVR"
     MIGADVPRDS QRARVYAAEA FVRTLFDRVT AHGSPTVEFF GTQLTLPPEG RFGSVASVQR        60
     YVDDVLALPA VGQNWPTVSP VRVRARRAAT AAHYENHGGT GTIAVPDRHT AGWAMRELVV       120
     LHEVAHHLCQ VPPPHGPEFV ATVCTLTELV MGPEVGHVFR VVYAQEGVR                   169
//

If you have problems or comments...

PBIL Back to PBIL home page