(data stored in ACNUC7421 zone)

EMBL: CP001658.PE20

CP001658.PE20        Location/Qualifiers
FT   CDS             complement(23963..25546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00020"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00020"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23041"
FT                   /protein_id="ACT23041.1"
FT                   /translation="MGSQKRLVQRVERKLEQTVGDAFARIFGGSIVPQEVEALLRREAA
FT                   DGIQSLQGNRLLAPNEYIITLGVHDFEKLGADPELKSTGFARDLADYIQEQGWQTYGDV
FT                   VVRFEQSSNLHTGQFRARGTVNPDVETHPPVIDCARPQSNHAFGAEPGVAPMSDNSSYR
FT                   GGQGQGRPDEYYDDRYARPQEDPRGGPDPQGGSDPRGGYPPETGGYPPQPGYPRPRHPD
FT                   QGDYPEQIGYPDQGGYPEQRGYPEQRGYPDQRGYQDQGRGYPDQGQGGYPPPYEQRPPV
FT                   SPGPAAGYGAPGYDQGYRQSGGYGPSPGGGQPGYGGYGEYGRGPARHEEGSYVPSGPPG
FT                   PPEQRPAYPDQGGYDQGYQQGATTYGRQDYGGGADYTRYTESPRVPGYAPQGGGYAEPA
FT                   GRDYDYGQSGAPDYGQPAPGGYSGYGQGGYGSAGTSVTLQLDDGSGRTYQLREGSNIIG
FT                   RGQDAQFRLPDTGVSRRHLEIRWDGQVALLADLNSTNGTTVNNAPVQEWQLADGDVIRL
FT                   GHSEIIVRMH"
     MGSQKRLVQR VERKLEQTVG DAFARIFGGS IVPQEVEALL RREAADGIQS LQGNRLLAPN        60
     EYIITLGVHD FEKLGADPEL KSTGFARDLA DYIQEQGWQT YGDVVVRFEQ SSNLHTGQFR       120
     ARGTVNPDVE THPPVIDCAR PQSNHAFGAE PGVAPMSDNS SYRGGQGQGR PDEYYDDRYA       180
     RPQEDPRGGP DPQGGSDPRG GYPPETGGYP PQPGYPRPRH PDQGDYPEQI GYPDQGGYPE       240
     QRGYPEQRGY PDQRGYQDQG RGYPDQGQGG YPPPYEQRPP VSPGPAAGYG APGYDQGYRQ       300
     SGGYGPSPGG GQPGYGGYGE YGRGPARHEE GSYVPSGPPG PPEQRPAYPD QGGYDQGYQQ       360
     GATTYGRQDY GGGADYTRYT ESPRVPGYAP QGGGYAEPAG RDYDYGQSGA PDYGQPAPGG       420
     YSGYGQGGYG SAGTSVTLQL DDGSGRTYQL REGSNIIGRG QDAQFRLPDT GVSRRHLEIR       480
     WDGQVALLAD LNSTNGTTVN NAPVQEWQLA DGDVIRLGHS EIIVRMH                     527
//

If you have problems or comments...

PBIL Back to PBIL home page