(data stored in ACNUC7421 zone)

EMBL: CP001658.PE201

CP001658.PE201       Location/Qualifiers
FT   CDS             226817..230401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00195"
FT                   /product="drugs-transport transmembrane ATP-binding protein
FT                   ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00195"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23222"
FT                   /protein_id="ACT23222.1"
FT                   /translation="MRTNCWWRLSGYVMRHRRDLLLGFGAALAGTVIAVLVPLVTKRVI
FT                   DDAIAADHRPLAPWAVVLVAAAGATYLLTYVRRYYGGRIAHLVQHDLRMDAFQALLRWD
FT                   GRQQDRWSSGQLIVRTTNDLQLVQALLFDVPNVLRHVLTLLLGVAVMTWLSVPLALLAV
FT                   LLVPVIGLIAHRSRRLLAAATHCAQEHKAAVTGVVDAAVCGIRVVKAFGQEERETVKLV
FT                   TASRALYAAQLRVARLNAHFGPLLQTLPALGQMAVFALGGWMAAQGSITVGTFVAFWAC
FT                   LTLLARPACDLAGMLTIAQQARAGAVRVLELIDSRPTLVDGTKPLSPEARLSLEFQRVS
FT                   FGYVADRPVLREISLSVRAGETLAVVGAPGSGKSTLASLATRCYDVTQGAVRIGGQDVR
FT                   ELTLDSLRSAIGLVPEDAVLFSGTIGANIAYGRPDATPEQIATAARAAHIEEFVNTLPD
FT                   GYQTAVGARGLTLSGGQRQRIALARALLHQPRLLIMDDPTSAVDAVIECGIQEVLREAI
FT                   ADRTAVIFTRRRSMLTLADRVAVLDSGRLLDVGTPDEVWERCPRYRELLSPAPDLADDL
FT                   VVAERSPVCRPVAGLGTKAAQHTNVHNPGPHDHPPGPDPLRRLLREFRGPLALSLLLVA
FT                   VQTCAGLLPPLLIRHGIDVGIRRHVLSALWWAALAGTATVVIRWVVQWGSAMVAGYTGE
FT                   QVLFRLRSVVFAHAQRLGLDAFEDDGDAQIVTAVTADVEAIVAFLRTGLVVAVISVVTL
FT                   VGILVALLAIRARLVLLIFTTMPVLALATWQFRRASNWTYRRARHRLGTVTATLREYAA
FT                   GLRIAQAFRAEYRGLQSYFAHSDDYRRLGVRGQRLLALYYPFVALLCSLATTLVLLDGA
FT                   REVRAGVISVGALVTYLLYIELLYTPIGELAQMFDDYQRAAVAAGRIRSLLSTRTPSSP
FT                   AARPVGTLRGEVVFDAVHYSYRTREVPALAGINLRIPAGQTVVFVGSTGSGKSTLIKLV
FT                   ARFYDPTHGTVRVDGCDLREFDVDGYRNRLGIVTQEQYVFAGTVRDAIAYGRPDATDAQ
FT                   VERAAREVGAHPMITALDNGYLHQVTAGGRNLSAGQLQLLALARARLVDPDILLLDEAT
FT                   VALDPATEAVVQRATLTLAARRTTLIVAHGLAIAEHADRIVVLEHGTVVEDGAHTELLA
FT                   AGGHYSRLWAAHTRLCSPEITQLQCIDA"
     MRTNCWWRLS GYVMRHRRDL LLGFGAALAG TVIAVLVPLV TKRVIDDAIA ADHRPLAPWA        60
     VVLVAAAGAT YLLTYVRRYY GGRIAHLVQH DLRMDAFQAL LRWDGRQQDR WSSGQLIVRT       120
     TNDLQLVQAL LFDVPNVLRH VLTLLLGVAV MTWLSVPLAL LAVLLVPVIG LIAHRSRRLL       180
     AAATHCAQEH KAAVTGVVDA AVCGIRVVKA FGQEERETVK LVTASRALYA AQLRVARLNA       240
     HFGPLLQTLP ALGQMAVFAL GGWMAAQGSI TVGTFVAFWA CLTLLARPAC DLAGMLTIAQ       300
     QARAGAVRVL ELIDSRPTLV DGTKPLSPEA RLSLEFQRVS FGYVADRPVL REISLSVRAG       360
     ETLAVVGAPG SGKSTLASLA TRCYDVTQGA VRIGGQDVRE LTLDSLRSAI GLVPEDAVLF       420
     SGTIGANIAY GRPDATPEQI ATAARAAHIE EFVNTLPDGY QTAVGARGLT LSGGQRQRIA       480
     LARALLHQPR LLIMDDPTSA VDAVIECGIQ EVLREAIADR TAVIFTRRRS MLTLADRVAV       540
     LDSGRLLDVG TPDEVWERCP RYRELLSPAP DLADDLVVAE RSPVCRPVAG LGTKAAQHTN       600
     VHNPGPHDHP PGPDPLRRLL REFRGPLALS LLLVAVQTCA GLLPPLLIRH GIDVGIRRHV       660
     LSALWWAALA GTATVVIRWV VQWGSAMVAG YTGEQVLFRL RSVVFAHAQR LGLDAFEDDG       720
     DAQIVTAVTA DVEAIVAFLR TGLVVAVISV VTLVGILVAL LAIRARLVLL IFTTMPVLAL       780
     ATWQFRRASN WTYRRARHRL GTVTATLREY AAGLRIAQAF RAEYRGLQSY FAHSDDYRRL       840
     GVRGQRLLAL YYPFVALLCS LATTLVLLDG AREVRAGVIS VGALVTYLLY IELLYTPIGE       900
     LAQMFDDYQR AAVAAGRIRS LLSTRTPSSP AARPVGTLRG EVVFDAVHYS YRTREVPALA       960
     GINLRIPAGQ TVVFVGSTGS GKSTLIKLVA RFYDPTHGTV RVDGCDLREF DVDGYRNRLG      1020
     IVTQEQYVFA GTVRDAIAYG RPDATDAQVE RAAREVGAHP MITALDNGYL HQVTAGGRNL      1080
     SAGQLQLLAL ARARLVDPDI LLLDEATVAL DPATEAVVQR ATLTLAARRT TLIVAHGLAI      1140
     AEHADRIVVL EHGTVVEDGA HTELLAAGGH YSRLWAAHTR LCSPEITQLQ CIDA            1194
//

If you have problems or comments...

PBIL Back to PBIL home page