(data stored in ACNUC7421 zone)

EMBL: CP001658.PE206

CP001658.PE206       Location/Qualifiers
FT   CDS             236491..237150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00200"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00200"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23227"
FT                   /protein_id="ACT23227.1"
FT                   /translation="MPDGEQSQPPAQEDAEDDSRPDAAEAAAAEPKSSAGPMFSTYGIA
FT                   STLLGVLSVAAVVLGAMIWSAHRDDSGERTYLTRVMLTAAEWTAVLINMNADNIDASLQ
FT                   RLHDGTVGQLNTDFDAVVQPYRQVVEKLRTHSSGRIEAVAIDTVHRELDTQSGAARPVV
FT                   TTKLPPFATRTDSVLLVATSVSENAGAKPQTVHWNLRLDVSDVDGKLMISRLESIR"
     MPDGEQSQPP AQEDAEDDSR PDAAEAAAAE PKSSAGPMFS TYGIASTLLG VLSVAAVVLG        60
     AMIWSAHRDD SGERTYLTRV MLTAAEWTAV LINMNADNID ASLQRLHDGT VGQLNTDFDA       120
     VVQPYRQVVE KLRTHSSGRI EAVAIDTVHR ELDTQSGAAR PVVTTKLPPF ATRTDSVLLV       180
     ATSVSENAGA KPQTVHWNLR LDVSDVDGKL MISRLESIR                              219
//

If you have problems or comments...

PBIL Back to PBIL home page