(data stored in ACNUC7421 zone)

EMBL: CP001658.PE207

CP001658.PE207       Location/Qualifiers
FT   CDS             237147..237836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00201"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00201"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23228"
FT                   /protein_id="ACT23228.1"
FT                   /translation="MRNAWRLVVFDVLAPLATIAALAAIGVLLGWPLWWVSTCSVLVLL
FT                   VVEGVAINFWLLRRDSVTVGTDDDAPGLRLAVVFLCAAAISAAVVTGYLRWTTPDRDFN
FT                   RDSREVVHLATGMAETVASFSPSAPAAAVDRAAAMMVPEHAGGFKEQYAKSSADLARRG
FT                   VTAQAATLAAGVEAIGPSAASVAVILRVSQSIPGQPTSQAARALRVTLTKRGSGWLVLD
FT                   VTPINAR"
     MRNAWRLVVF DVLAPLATIA ALAAIGVLLG WPLWWVSTCS VLVLLVVEGV AINFWLLRRD        60
     SVTVGTDDDA PGLRLAVVFL CAAAISAAVV TGYLRWTTPD RDFNRDSREV VHLATGMAET       120
     VASFSPSAPA AAVDRAAAMM VPEHAGGFKE QYAKSSADLA RRGVTAQAAT LAAGVEAIGP       180
     SAASVAVILR VSQSIPGQPT SQAARALRVT LTKRGSGWLV LDVTPINAR                   229
//

If you have problems or comments...

PBIL Back to PBIL home page