(data stored in ACNUC7421 zone)

EMBL: CP001658.PE217

CP001658.PE217       Location/Qualifiers
FT   CDS             250061..251539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00211"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23238"
FT                   /protein_id="ACT23238.1"
FT                   /translation="MIRAASDDPAGVDELVAAIAPGLAGLGLPVINRREVVLVTGPWLA
FT                   GVSGVRAALAERLPQRRFVETAELGPGDAPVAVVFVVSAATALTESDCVLLDTAAEHTD
FT                   AVVAVVSKIDVHRGWRDVLTSNRDRLAARASRYARVPWVGAAAAPELGEPYLDDLVAAI
FT                   QKQLADPAVARRNMLRAWESRLLMVARRFDGDAQSAGRRARVDALRQQRRTVLRQGRQS
FT                   KSEHTIALRAQIQHARVKLSYFARNRCSLLRVELQEHVAGLSRKDIARFAAYTRGRVQE
FT                   VVAEVGEGAVAHLADVAQLLGVPVQPPVLENLPAVLPTVVAPPLTSRRLEIRLTTLLGA
FT                   GFGLGIALTLSRLVAGLTPGLAASGMVAGVAIGLAVTAWVVNARALLHDRVVVDRWTGE
FT                   VTASLRSVVEQLVATRVVAVETLLSTAISERDDAENARVADQVSIIDGELREHAVAAAR
FT                   AAALRDREMPAVRAALEAVRAELGEPGAPTTGLF"
     MIRAASDDPA GVDELVAAIA PGLAGLGLPV INRREVVLVT GPWLAGVSGV RAALAERLPQ        60
     RRFVETAELG PGDAPVAVVF VVSAATALTE SDCVLLDTAA EHTDAVVAVV SKIDVHRGWR       120
     DVLTSNRDRL AARASRYARV PWVGAAAAPE LGEPYLDDLV AAIQKQLADP AVARRNMLRA       180
     WESRLLMVAR RFDGDAQSAG RRARVDALRQ QRRTVLRQGR QSKSEHTIAL RAQIQHARVK       240
     LSYFARNRCS LLRVELQEHV AGLSRKDIAR FAAYTRGRVQ EVVAEVGEGA VAHLADVAQL       300
     LGVPVQPPVL ENLPAVLPTV VAPPLTSRRL EIRLTTLLGA GFGLGIALTL SRLVAGLTPG       360
     LAASGMVAGV AIGLAVTAWV VNARALLHDR VVVDRWTGEV TASLRSVVEQ LVATRVVAVE       420
     TLLSTAISER DDAENARVAD QVSIIDGELR EHAVAAARAA ALRDREMPAV RAALEAVRAE       480
     LGEPGAPTTG LF                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page