(data stored in ACNUC7421 zone)

EMBL: CP001658.PE228

CP001658.PE228       Location/Qualifiers
FT   CDS             264008..265417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00222"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00222"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23249"
FT                   /protein_id="ACT23249.1"
FT                   /translation="MKRLSGWDAVLLYSETPNVHMHTLKVAVIELDSDRQEFGVDAFRE
FT                   VIAGRLHKLEPLGYQLVDVPLKFHHPMWREHCQVDLNYHIRPWRLRAPGGRRELDEAVG
FT                   EIASTPLNRDHPLWEMYFVEGLANHRIAVVAKIHHALADGVASANMMARGMDLLPGPEV
FT                   GRYVPDPAPTKRQLLSAAFIDHLRHLGRIPATIRYTTQGLGRVRRSSRKLSPALTMPFT
FT                   PPPTFMNHRLTPERRFATATLALIDVKATAKLLGATINDMVLAMSTGALRTLLLRYDGK
FT                   AEPLLASVPVSYDFSPERISGNRFTGMLVALPADSDDPLQRVRVCHENAVSAKESHQLL
FT                   GPELISRWAAYWPPAGAEALFRWLSERDGQNKVLNLNISNVPGPRERGRVGAALVTEIY
FT                   SVGPLTAGSGLNITVWSYVDQLNISVLTDGSTVQDPHEVTAGMIADFIEIRRAAGLSVE
FT                   LTVVESAMAQA"
     MKRLSGWDAV LLYSETPNVH MHTLKVAVIE LDSDRQEFGV DAFREVIAGR LHKLEPLGYQ        60
     LVDVPLKFHH PMWREHCQVD LNYHIRPWRL RAPGGRRELD EAVGEIASTP LNRDHPLWEM       120
     YFVEGLANHR IAVVAKIHHA LADGVASANM MARGMDLLPG PEVGRYVPDP APTKRQLLSA       180
     AFIDHLRHLG RIPATIRYTT QGLGRVRRSS RKLSPALTMP FTPPPTFMNH RLTPERRFAT       240
     ATLALIDVKA TAKLLGATIN DMVLAMSTGA LRTLLLRYDG KAEPLLASVP VSYDFSPERI       300
     SGNRFTGMLV ALPADSDDPL QRVRVCHENA VSAKESHQLL GPELISRWAA YWPPAGAEAL       360
     FRWLSERDGQ NKVLNLNISN VPGPRERGRV GAALVTEIYS VGPLTAGSGL NITVWSYVDQ       420
     LNISVLTDGS TVQDPHEVTA GMIADFIEIR RAAGLSVELT VVESAMAQA                   469
//

If you have problems or comments...

PBIL Back to PBIL home page