(data stored in ACNUC7421 zone)

EMBL: CP001658.PE232

CP001658.PE232       Location/Qualifiers
FT   CDS             268604..269758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00226"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00226"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23253"
FT                   /protein_id="ACT23253.1"
FT                   /translation="MSALRSVLLLCWRDIGHPQGGGSEAYLQRIGAQLAASGIAVTLRT
FT                   ARYPGAPRHELVDGVRISRAGGRYSVYLWALLAMAAARCGLGPLRRVRPDVVVDTQNGW
FT                   PFVARLLYGRRSLVLVHHCHREQWPVAGRMMGRLGWYVESMLSPRLHRRNQYVTVSLPS
FT                   ARDLIALGVDSERIAVVRNGLDEAPSPTLSGPRAPTPRVVVLSRLVPHKQIEDALAAVA
FT                   ELQPRIPGLHLDIVGGGWWRQRLVDHVHRLDIADAVTFHGHVDDVTKHHVLQSSWVHLL
FT                   PSRKEGWGLAVIEAAQHGVPTIGYRSSGGLADSIVDGVTGILVDDRAELVAWLEQLLSD
FT                   SVLRDQLGAKAQARSGEFSWRQSAEALRSVLEAVQASRFVSGVV"
     MSALRSVLLL CWRDIGHPQG GGSEAYLQRI GAQLAASGIA VTLRTARYPG APRHELVDGV        60
     RISRAGGRYS VYLWALLAMA AARCGLGPLR RVRPDVVVDT QNGWPFVARL LYGRRSLVLV       120
     HHCHREQWPV AGRMMGRLGW YVESMLSPRL HRRNQYVTVS LPSARDLIAL GVDSERIAVV       180
     RNGLDEAPSP TLSGPRAPTP RVVVLSRLVP HKQIEDALAA VAELQPRIPG LHLDIVGGGW       240
     WRQRLVDHVH RLDIADAVTF HGHVDDVTKH HVLQSSWVHL LPSRKEGWGL AVIEAAQHGV       300
     PTIGYRSSGG LADSIVDGVT GILVDDRAEL VAWLEQLLSD SVLRDQLGAK AQARSGEFSW       360
     RQSAEALRSV LEAVQASRFV SGVV                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page