(data stored in ACNUC7421 zone)

EMBL: CP001658.PE25

CP001658.PE25        Location/Qualifiers
FT   CDS             29347..29709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00025"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00025"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23046"
FT                   /protein_id="ACT23046.1"
FT                   /translation="MSEQAGSSVAVIQERQALLARQHDAVAEADRELADVLASAHAAMR
FT                   ESVRRLDAIAAELDRAVPDQDQLAVDTPMGAREFQTFLVAKQREIVAVVAAAHELDRAK
FT                   SAVLKRLRAQYTEPAR"
     MSEQAGSSVA VIQERQALLA RQHDAVAEAD RELADVLASA HAAMRESVRR LDAIAAELDR        60
     AVPDQDQLAV DTPMGAREFQ TFLVAKQREI VAVVAAAHEL DRAKSAVLKR LRAQYTEPAR       120
//

If you have problems or comments...

PBIL Back to PBIL home page