(data stored in ACNUC7421 zone)

EMBL: CP001658.PE251

CP001658.PE251       Location/Qualifiers
FT   CDS             complement(290606..291970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00244"
FT                   /product="3-oxoacyl-[acyl-carrier protein] reductase fabG4"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00244"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23272"
FT                   /protein_id="ACT23272.1"
FT                   /translation="MAPKRSSDLFSQVVNSGPGSFLARQLGVPQPETLRRYRAGEPPLT
FT                   GSLLIGGAGRVVEPLRAALEKDYDLVGNNLGGRWADSFGGLVFDATGITEPAGLKGLHE
FT                   FFTPVLRNLGRCGRVVVVGGTPEAAASTNERIAQRALEGFTRSLGKELRRGATTALVYL
FT                   SPDAKPAATGLESTMRFLLSAKSAYVDGQVFSVGADDSTPPADWEKPLDGKVAIVTGAA
FT                   RGIGATIAEVFARDGAHVVAIDVESAAENLAETASKVGGTALWLDVTADDAVDKISEHL
FT                   RDHHGGKADILVNNAGITRDKLLANMDDARWDAVLAVNLLAPLRLTEGLVGNGSIGEGG
FT                   RVIGLSSIAGIAGNRGQTNYATTKAGMIGITQALAPGLAAKGITINAVAPGFIETQMTA
FT                   AIPLATREVGRRLNSLLQGGQPVDVAEAIAYFASPASNAVTGNVIRVCGQAMIGA"
     MAPKRSSDLF SQVVNSGPGS FLARQLGVPQ PETLRRYRAG EPPLTGSLLI GGAGRVVEPL        60
     RAALEKDYDL VGNNLGGRWA DSFGGLVFDA TGITEPAGLK GLHEFFTPVL RNLGRCGRVV       120
     VVGGTPEAAA STNERIAQRA LEGFTRSLGK ELRRGATTAL VYLSPDAKPA ATGLESTMRF       180
     LLSAKSAYVD GQVFSVGADD STPPADWEKP LDGKVAIVTG AARGIGATIA EVFARDGAHV       240
     VAIDVESAAE NLAETASKVG GTALWLDVTA DDAVDKISEH LRDHHGGKAD ILVNNAGITR       300
     DKLLANMDDA RWDAVLAVNL LAPLRLTEGL VGNGSIGEGG RVIGLSSIAG IAGNRGQTNY       360
     ATTKAGMIGI TQALAPGLAA KGITINAVAP GFIETQMTAA IPLATREVGR RLNSLLQGGQ       420
     PVDVAEAIAY FASPASNAVT GNVIRVCGQA MIGA                                   454
//

If you have problems or comments...

PBIL Back to PBIL home page