(data stored in ACNUC7421 zone)

EMBL: CP001658.PE255

CP001658.PE255       Location/Qualifiers
FT   CDS             296749..298059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00248"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00248"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23276"
FT                   /protein_id="ACT23276.1"
FT                   /translation="MAKTSHRVSSADGMSKRILRLIIAQSGFYSAALQLGNVSIVLPFV
FT                   VAELDAELWIAALIFPAFTAGGAIGNVVAPPAVAAVPRRHRLFIIVSCLAVLAGVNALC
FT                   ATIGKGSVAGILLVVNVTLIGVVSAISFVAFADLVAAMPSGTARARILLTEVGVGAALT
FT                   AVVAATLSFVPDQHPLSRNIHLLWTAAVAMAISAAICRALPHRIVPRVHAAPGLHKLVY
FT                   VGWTAIRTNGWYRRYLLVQVLFGSVVLGSSFHSIRVAAVPGDQPDEVVAVVLFVCVGLL
FT                   GGIALWNRVRERFGLVGLFVGSALVSIAAAVLSIAFDLAGAWPNVVAIGLVIALVSIAN
FT                   QSVFTAGQLWIARDAEPGLRTSLISFGQLVINAGLVGMGLALGLIAQDHDAVWPVMIVL
FT                   LLNLTAAYSATRFAPAKSVDVRGLPQVSRTSRPKTGG"
     MAKTSHRVSS ADGMSKRILR LIIAQSGFYS AALQLGNVSI VLPFVVAELD AELWIAALIF        60
     PAFTAGGAIG NVVAPPAVAA VPRRHRLFII VSCLAVLAGV NALCATIGKG SVAGILLVVN       120
     VTLIGVVSAI SFVAFADLVA AMPSGTARAR ILLTEVGVGA ALTAVVAATL SFVPDQHPLS       180
     RNIHLLWTAA VAMAISAAIC RALPHRIVPR VHAAPGLHKL VYVGWTAIRT NGWYRRYLLV       240
     QVLFGSVVLG SSFHSIRVAA VPGDQPDEVV AVVLFVCVGL LGGIALWNRV RERFGLVGLF       300
     VGSALVSIAA AVLSIAFDLA GAWPNVVAIG LVIALVSIAN QSVFTAGQLW IARDAEPGLR       360
     TSLISFGQLV INAGLVGMGL ALGLIAQDHD AVWPVMIVLL LNLTAAYSAT RFAPAKSVDV       420
     RGLPQVSRTS RPKTGG                                                       436
//

If you have problems or comments...

PBIL Back to PBIL home page