(data stored in ACNUC7421 zone)

EMBL: CP001658.PE260

CP001658.PE260       Location/Qualifiers
FT   CDS             complement(302113..302592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00253"
FT                   /product="heat shock protein hsp"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00253"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23281"
FT                   /protein_id="ACT23281.1"
FT                   /translation="MNNLALWSRPVWDVEPWDRWLRDFFGPAATTDWYRPVAGDFTPAA
FT                   EIVKDGDDAVVRLELPGIDVDKDVNVELDPGQPVSRLVIRGEHRDEHTQDAGDKDGRTL
FT                   REIRYGSFRRSFRLPAHVTSEAIAASYDAGVLTVRVAGAYKAPAETQAQRIAITK"
     MNNLALWSRP VWDVEPWDRW LRDFFGPAAT TDWYRPVAGD FTPAAEIVKD GDDAVVRLEL        60
     PGIDVDKDVN VELDPGQPVS RLVIRGEHRD EHTQDAGDKD GRTLREIRYG SFRRSFRLPA       120
     HVTSEAIAAS YDAGVLTVRV AGAYKAPAET QAQRIAITK                              159
//

If you have problems or comments...

PBIL Back to PBIL home page