(data stored in ACNUC7421 zone)

EMBL: CP001658.PE261

CP001658.PE261       Location/Qualifiers
FT   CDS             302806..305367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00254"
FT                   /product="nitrite reductase [NAD(P)H] large subunit nirB"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00254"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23282"
FT                   /protein_id="ACT23282.1"
FT                   /translation="MPTAGSSRAPAAAREIVVVGHGMVGHRLVEAVRARDADGSLRITV
FT                   LAEEGDAAYDRVGLTSYTESWDRALLALPGNDYAGDQRVRLLLNTRVTQIDRATKSVVT
FT                   AAGQRHRYDTLVLATGSYAFVPPVPGHDLPACHVYRTFDDLDAIRAGAQRTLDGGHTDG
FT                   GVVIGGGLLGLEAANALRQFGLQTHVVEMMPRLMAQQIDEAGGALLARMIADLGIAVHV
FT                   GTGTESIESVKHSDGSVWARVRLSDGEVIDAGVVIFAAGIRPRDELARAAGLAIGDRGG
FT                   VLTDLSCRTSDPDIYAVGEVAAIDGRCYGLVGPGYTSAEVVADRLLDGSAEFPEADLST
FT                   KLKLLGVDVASFGDAMGATENCLEVVINDAVKRTYAKLVLSDDATTLLGGVLVGDASSY
FT                   GVLRPMVGAELPGDPLALIAPAGSGAGAGALGVGALPDSAQICSCNNVTKGELKCAIAD
FT                   GCGDVPALKSCTAAGTSCGSCVPLLKQLLEAEGVEQSKALCEHFSQSRAELFEIITATE
FT                   VRTFSGLLDRFGRGKGCDICKPVVASILASTGSDHILDGEQASLQDSNDHFLANIQKNG
FT                   SYSVVPRVPGGDIKPEHLILIGQIAQDFGLYTKITGGQRIDLFGARVDQLPLIWQRLVD
FT                   GGMESGHAYGKAVRTVKSCVGSDWCRYGQQDSVQLAIDLELRYRGLRAPHKIKLGVSGC
FT                   ARECAEARGKDVGVIATEKGWNLYVAGNGGMTPKHAQLLASDLDKETLIRYIDRFLIYY
FT                   IRTADRLQRTAPWVESLGLDHVREVVCEDSLGLAEEFEAAMQRHVANYKCEWKGVLEDP
FT                   DKLSRFVSFVNAPDAVDSTVTFTERAGRKVPVSIGIPRVRS"
     MPTAGSSRAP AAAREIVVVG HGMVGHRLVE AVRARDADGS LRITVLAEEG DAAYDRVGLT        60
     SYTESWDRAL LALPGNDYAG DQRVRLLLNT RVTQIDRATK SVVTAAGQRH RYDTLVLATG       120
     SYAFVPPVPG HDLPACHVYR TFDDLDAIRA GAQRTLDGGH TDGGVVIGGG LLGLEAANAL       180
     RQFGLQTHVV EMMPRLMAQQ IDEAGGALLA RMIADLGIAV HVGTGTESIE SVKHSDGSVW       240
     ARVRLSDGEV IDAGVVIFAA GIRPRDELAR AAGLAIGDRG GVLTDLSCRT SDPDIYAVGE       300
     VAAIDGRCYG LVGPGYTSAE VVADRLLDGS AEFPEADLST KLKLLGVDVA SFGDAMGATE       360
     NCLEVVINDA VKRTYAKLVL SDDATTLLGG VLVGDASSYG VLRPMVGAEL PGDPLALIAP       420
     AGSGAGAGAL GVGALPDSAQ ICSCNNVTKG ELKCAIADGC GDVPALKSCT AAGTSCGSCV       480
     PLLKQLLEAE GVEQSKALCE HFSQSRAELF EIITATEVRT FSGLLDRFGR GKGCDICKPV       540
     VASILASTGS DHILDGEQAS LQDSNDHFLA NIQKNGSYSV VPRVPGGDIK PEHLILIGQI       600
     AQDFGLYTKI TGGQRIDLFG ARVDQLPLIW QRLVDGGMES GHAYGKAVRT VKSCVGSDWC       660
     RYGQQDSVQL AIDLELRYRG LRAPHKIKLG VSGCARECAE ARGKDVGVIA TEKGWNLYVA       720
     GNGGMTPKHA QLLASDLDKE TLIRYIDRFL IYYIRTADRL QRTAPWVESL GLDHVREVVC       780
     EDSLGLAEEF EAAMQRHVAN YKCEWKGVLE DPDKLSRFVS FVNAPDAVDS TVTFTERAGR       840
     KVPVSIGIPR VRS                                                          853
//

If you have problems or comments...

PBIL Back to PBIL home page