(data stored in ACNUC7421 zone)

EMBL: CP001658.PE262

CP001658.PE262       Location/Qualifiers
FT   CDS             305393..305749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00255"
FT                   /product="nitrite reductase [NAD(P)H] small subunit nirD"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00255"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23283"
FT                   /protein_id="ACT23283.1"
FT                   /translation="MTLLNDIQVWTTACAYDHLIPGRGVGVLLDDGSQVALFRLDDGSV
FT                   HAVGNVDPFSGAAVMSRGIVGDRGGRAMVQSPILKQAFALDDGSCLDDPRVSVPVYPAR
FT                   VTPEGRIQVARVAV"
     MTLLNDIQVW TTACAYDHLI PGRGVGVLLD DGSQVALFRL DDGSVHAVGN VDPFSGAAVM        60
     SRGIVGDRGG RAMVQSPILK QAFALDDGSC LDDPRVSVPV YPARVTPEGR IQVARVAV         118
//

If you have problems or comments...

PBIL Back to PBIL home page