(data stored in ACNUC7421 zone)

EMBL: CP001658.PE263

CP001658.PE263       Location/Qualifiers
FT   CDS             complement(305765..306289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00256"
FT                   /product="bifunctional cobalamin biosynthesis protein cobU"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00256"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23284"
FT                   /protein_id="ACT23284.1"
FT                   /translation="MRILVTGGVRSGKSTHAEALLGDAADVVYVAPGRPAAGSDPDWDA
FT                   RVALHRARRPPTWLTVETADVATALSEARSPVLVDCLGTWLTAIMDGEALWSAATADVY
FT                   AVLEARLDGLCAALTGLPTAIVVTNEVGLGVVPSHSSGVLFRDLLGTINRRVAAVCDEV
FT                   HLVIAGRVLKL"
     MRILVTGGVR SGKSTHAEAL LGDAADVVYV APGRPAAGSD PDWDARVALH RARRPPTWLT        60
     VETADVATAL SEARSPVLVD CLGTWLTAIM DGEALWSAAT ADVYAVLEAR LDGLCAALTG       120
     LPTAIVVTNE VGLGVVPSHS SGVLFRDLLG TINRRVAAVC DEVHLVIAGR VLKL             174
//

If you have problems or comments...

PBIL Back to PBIL home page