(data stored in ACNUC7421 zone)

EMBL: CP001658.PE266

CP001658.PE266       Location/Qualifiers
FT   CDS             309639..310013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_03982"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_03982"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23287"
FT                   /protein_id="ACT23287.1"
FT                   /translation="MTRVSWLPDRCLPRLPACGRGLRGSLPGDSGGTAPDSHRLPASSS
FT                   PDGKNIGMQSVDLHVERHLPSRGRSHRTVATVTCVTALGDIRSAQLSATGAWPAVLFPS
FT                   WSWLCGIGGGVDLQKPSCRA"
     MTRVSWLPDR CLPRLPACGR GLRGSLPGDS GGTAPDSHRL PASSSPDGKN IGMQSVDLHV        60
     ERHLPSRGRS HRTVATVTCV TALGDIRSAQ LSATGAWPAV LFPSWSWLCG IGGGVDLQKP       120
     SCRA                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page