(data stored in ACNUC7421 zone)

EMBL: CP001658.PE269

CP001658.PE269       Location/Qualifiers
FT   CDS             complement(310714..311457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00261"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00261"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23290"
FT                   /protein_id="ACT23290.1"
FT                   /translation="MNLILTAHGTRRPSGVAMIADIAAQVSALVDRTVQVAFVDVLGPS
FT                   PSEVLSALSCRPAIVVPAFLSRGYHVRTDLPAHVAASAHPHVTVTPALGPCREIAQIVT
FT                   QQLVESGWRPGDSVILAAAGASDRRARADLHTTRTLVSELTGSWVDMGFAGTGGPDVRT
FT                   AVQRARDRAEANRGARRVVVASFLLAEGLFQERLRASGADVVTRPLGTHPGLAQLVANR
FT                   FRSAVARQQRLHRWHGTPTPVTLDL"
     MNLILTAHGT RRPSGVAMIA DIAAQVSALV DRTVQVAFVD VLGPSPSEVL SALSCRPAIV        60
     VPAFLSRGYH VRTDLPAHVA ASAHPHVTVT PALGPCREIA QIVTQQLVES GWRPGDSVIL       120
     AAAGASDRRA RADLHTTRTL VSELTGSWVD MGFAGTGGPD VRTAVQRARD RAEANRGARR       180
     VVVASFLLAE GLFQERLRAS GADVVTRPLG THPGLAQLVA NRFRSAVARQ QRLHRWHGTP       240
     TPVTLDL                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page