(data stored in ACNUC7421 zone)

EMBL: CP001658.PE27

CP001658.PE27        Location/Qualifiers
FT   CDS             31291..31608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00027"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23048"
FT                   /protein_id="ACT23048.1"
FT                   /translation="MTDRIHVQPAHLRQAAAHHQQTADYLRTVPSSHDAIRESLDSLGP
FT                   IFSELRDTGRELLELRKQCYQQQADNHADIAQNLRTSAAMWEQHERAASRSLGNIIDGS
FT                   R"
     MTDRIHVQPA HLRQAAAHHQ QTADYLRTVP SSHDAIRESL DSLGPIFSEL RDTGRELLEL        60
     RKQCYQQQAD NHADIAQNLR TSAAMWEQHE RAASRSLGNI IDGSR                       105
//

If you have problems or comments...

PBIL Back to PBIL home page