(data stored in ACNUC7421 zone)

EMBL: CP001658.PE278

CP001658.PE278       Location/Qualifiers
FT   CDS             complement(322704..323213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00270"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23299"
FT                   /protein_id="ACT23299.1"
FT                   /translation="MGTRSKSRTRQLKQSNGCTATTSGASDRRRRARRRTAPAWLREDE
FT                   WLRHHLPHPPRQLSRCLHRRRRSACHHRYSRRTPKGGLPMTSSLVPISEARAHLSRLVR
FT                   ESADDDVVLMNHGRPAAILISAERYESLMEELEDLRDRLSVHEREHVTMPLDKLGAELG
FT                   VDIGRV"
     MGTRSKSRTR QLKQSNGCTA TTSGASDRRR RARRRTAPAW LREDEWLRHH LPHPPRQLSR        60
     CLHRRRRSAC HHRYSRRTPK GGLPMTSSLV PISEARAHLS RLVRESADDD VVLMNHGRPA       120
     AILISAERYE SLMEELEDLR DRLSVHEREH VTMPLDKLGA ELGVDIGRV                   169
//

If you have problems or comments...

PBIL Back to PBIL home page