(data stored in ACNUC7421 zone)

EMBL: CP001658.PE28

CP001658.PE28        Location/Qualifiers
FT   CDS             31616..31921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00028"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23049"
FT                   /protein_id="ACT23049.1"
FT                   /translation="MTDANPAFDTVHPSGHILVRSCRGGYMHSVSLSEAAMETDAETLA
FT                   EAILLTADVSCLKALLEVRNEIVAAGHTPSAQVPTTDDLNVAIEKLLAHQLRRRNR"
     MTDANPAFDT VHPSGHILVR SCRGGYMHSV SLSEAAMETD AETLAEAILL TADVSCLKAL        60
     LEVRNEIVAA GHTPSAQVPT TDDLNVAIEK LLAHQLRRRN R                           101
//

If you have problems or comments...

PBIL Back to PBIL home page