(data stored in ACNUC7421 zone)

EMBL: CP001658.PE282

CP001658.PE282       Location/Qualifiers
FT   CDS             complement(328515..329648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00274"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00274"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23303"
FT                   /protein_id="ACT23303.1"
FT                   /translation="MTGRAATPGVIREFVGLPSRTAGRAAAGGHPCQGLYHHSVGRKPK
FT                   VALIAAHYQIDFSEHYLAEYMAIRGIGFLGWNTRFRGFESSFLLDHALVDIGVGVRWLR
FT                   EVQGVETVVLLGNSGGGSLMAAYQSQAVDPNVTPLDGMRPAAGVTELPAADAYVAAAAH
FT                   PGRPDVLTAWMDAAVIDENDPVATDPELDLFDERNGPPYSPEFISRYRSAQVKRNHTIT
FT                   DWAESELKRVRAAGFSDRPFSVMRTWADPRMVDPSIEPTKRRPNQCYAGTPVKANRSAH
FT                   GIAAACTLRGWLGMWSLRVAQTRAAPHLARITCPALVLNAEADTGIFPSDAQQIYDGLA
FT                   SSDKTQVSIDTDHYFTTPGARSEQADTIAKWIAKRWR"
     MTGRAATPGV IREFVGLPSR TAGRAAAGGH PCQGLYHHSV GRKPKVALIA AHYQIDFSEH        60
     YLAEYMAIRG IGFLGWNTRF RGFESSFLLD HALVDIGVGV RWLREVQGVE TVVLLGNSGG       120
     GSLMAAYQSQ AVDPNVTPLD GMRPAAGVTE LPAADAYVAA AAHPGRPDVL TAWMDAAVID       180
     ENDPVATDPE LDLFDERNGP PYSPEFISRY RSAQVKRNHT ITDWAESELK RVRAAGFSDR       240
     PFSVMRTWAD PRMVDPSIEP TKRRPNQCYA GTPVKANRSA HGIAAACTLR GWLGMWSLRV       300
     AQTRAAPHLA RITCPALVLN AEADTGIFPS DAQQIYDGLA SSDKTQVSID TDHYFTTPGA       360
     RSEQADTIAK WIAKRWR                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page