(data stored in ACNUC7421 zone)

EMBL: CP001658.PE286

CP001658.PE286       Location/Qualifiers
FT   CDS             331688..332608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00278"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00278"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23307"
FT                   /protein_id="ACT23307.1"
FT                   /translation="MAISLVAHQPIPHVERPMADPPRLQLARRRRSAAGPGGNEDSLMG
FT                   VALLAGPANVIMELAMPGVGYGVLESRVESGRLDRHPIKRARTTFTYVAVAVAGSDDQK
FT                   AAFRRAVNKVHAQVYSTPESPVSYHAFDPELQLWVAACLYKGGVDVYRTFVGEMDDEEA
FT                   DHHYRAGMAMGTTLQVPPQMWPPDRAAFDRYWRQSLDRVHIDDVVRDYLYPIVALRIRG
FT                   IALPGPLRRLSEGIALLITTGFLPQRFRDEMRLPWDATKQRRFDALMAVLRTVNRLMPR
FT                   FVREFPFNLMLWDLDRRMRRGRPLV"
     MAISLVAHQP IPHVERPMAD PPRLQLARRR RSAAGPGGNE DSLMGVALLA GPANVIMELA        60
     MPGVGYGVLE SRVESGRLDR HPIKRARTTF TYVAVAVAGS DDQKAAFRRA VNKVHAQVYS       120
     TPESPVSYHA FDPELQLWVA ACLYKGGVDV YRTFVGEMDD EEADHHYRAG MAMGTTLQVP       180
     PQMWPPDRAA FDRYWRQSLD RVHIDDVVRD YLYPIVALRI RGIALPGPLR RLSEGIALLI       240
     TTGFLPQRFR DEMRLPWDAT KQRRFDALMA VLRTVNRLMP RFVREFPFNL MLWDLDRRMR       300
     RGRPLV                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page