(data stored in ACNUC7421 zone)

EMBL: CP001658.PE289

CP001658.PE289       Location/Qualifiers
FT   CDS             complement(333377..336280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_03983"
FT                   /product="PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_03983"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23310"
FT                   /protein_id="ACT23310.1"
FT                   /translation="MLPLEMGCFLQPIFTGDRGGPGRRDRAVMPVGRCQMSFVIAAPEV
FT                   IAAAATDLASLESSIAAANAAAAANTTALLAAGADEVSTAVAALFGAHGQAYQALSAQA
FT                   QAFHAQFTQALTSGGGAYAAAEAAAVSPLLDPINEFFLANTGRPLIGNGTNGAPGTGAD
FT                   GAPGGWLIGNGGAGGSGAANNAVGGTGGTGGAGGASGLLGSGGAGGAGGVATNTGGIGG
FT                   AGGTGGNAVLFGAGGASTNTTGGAGGAGGDGGNAGLLFGAAGVGGAGGFALATTASGGA
FT                   GGAGGAGGMFTDGGVGGVGGKGGFGGAGGAGGNGGLFGAGGTGGAGGTIGAGVAGMGGA
FT                   GGAGGAGGLFGAGGTGGSGGGGATTGGDGGAGGNAGTLSLGAAGGAGGAGGEGLASAGG
FT                   DGGAGGDGGNAGMFFGSGGAGGAGGFGRTTGGIGGTGGNAGLLNGSGGAGGAGGAAITG
FT                   PGGTGGAGGIPGLIGNGGNGGDGGASVTGTGGNGGAGGNGVQIGNGGNGGSGGTGAAAG
FT                   KAGLGGLGGQLIGLDGSNAPVSTSVHTLQQAALNVVNEPFQTLTGRPLIGNGANGTPGT
FT                   GAAGGAGGWLFGNGGNGGHGATNTAATATGGAGGAGGILFGTGGNGGTGGIATGAGGIG
FT                   GAGGAGGVSLLIGSGGTGGNGGNSIGVAGIGGAGGRGGDAGLLFGAAGTGGHGAAGGVP
FT                   AGVGGAGGNGGLFANGGAGGAGGFNAAGGNGGNGGLFGTGGTGGAGTNFGAGGNGGNGG
FT                   LFGAGGTGGAAGSGGSGITTGGGGHGGNAGLLSLGASGGAGGSGGASSLAGGAGGNGAL
FT                   LFGFGGAGGAGGHGGAALTSIQQGGAGGAGGNGGLLFGSAGAGGAGGSGANALGAGTGG
FT                   TGGDGGHAGVFGNGGDGGCRRVWRRYRRQRWCRRQRRADRQRRQRRQRRQSRGHARCRR
FT                   HRRAAARRERTQRLAIAGRPATTRGVEGISCSPQMMP"
     MLPLEMGCFL QPIFTGDRGG PGRRDRAVMP VGRCQMSFVI AAPEVIAAAA TDLASLESSI        60
     AAANAAAAAN TTALLAAGAD EVSTAVAALF GAHGQAYQAL SAQAQAFHAQ FTQALTSGGG       120
     AYAAAEAAAV SPLLDPINEF FLANTGRPLI GNGTNGAPGT GADGAPGGWL IGNGGAGGSG       180
     AANNAVGGTG GTGGAGGASG LLGSGGAGGA GGVATNTGGI GGAGGTGGNA VLFGAGGAST       240
     NTTGGAGGAG GDGGNAGLLF GAAGVGGAGG FALATTASGG AGGAGGAGGM FTDGGVGGVG       300
     GKGGFGGAGG AGGNGGLFGA GGTGGAGGTI GAGVAGMGGA GGAGGAGGLF GAGGTGGSGG       360
     GGATTGGDGG AGGNAGTLSL GAAGGAGGAG GEGLASAGGD GGAGGDGGNA GMFFGSGGAG       420
     GAGGFGRTTG GIGGTGGNAG LLNGSGGAGG AGGAAITGPG GTGGAGGIPG LIGNGGNGGD       480
     GGASVTGTGG NGGAGGNGVQ IGNGGNGGSG GTGAAAGKAG LGGLGGQLIG LDGSNAPVST       540
     SVHTLQQAAL NVVNEPFQTL TGRPLIGNGA NGTPGTGAAG GAGGWLFGNG GNGGHGATNT       600
     AATATGGAGG AGGILFGTGG NGGTGGIATG AGGIGGAGGA GGVSLLIGSG GTGGNGGNSI       660
     GVAGIGGAGG RGGDAGLLFG AAGTGGHGAA GGVPAGVGGA GGNGGLFANG GAGGAGGFNA       720
     AGGNGGNGGL FGTGGTGGAG TNFGAGGNGG NGGLFGAGGT GGAAGSGGSG ITTGGGGHGG       780
     NAGLLSLGAS GGAGGSGGAS SLAGGAGGNG ALLFGFGGAG GAGGHGGAAL TSIQQGGAGG       840
     AGGNGGLLFG SAGAGGAGGS GANALGAGTG GTGGDGGHAG VFGNGGDGGC RRVWRRYRRQ       900
     RWCRRQRRAD RQRRQRRQRR QSRGHARCRR HRRAAARRER TQRLAIAGRP ATTRGVEGIS       960
     CSPQMMP                                                                 967
//

If you have problems or comments...

PBIL Back to PBIL home page