(data stored in ACNUC7421 zone)

EMBL: CP001658.PE292

CP001658.PE292       Location/Qualifiers
FT   CDS             342231..343841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00285"
FT                   /product="PPE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00285"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23313"
FT                   /protein_id="ACT23313.1"
FT                   /translation="MTLWMASPPEVHSALLSSGPGPGSVLSAAGVWSSLSAEYAAVADE
FT                   LIGLLGAVQTGAWQGPSAAAYVAAHAPYLAWLMRASETSAEAAARHETVAAAYTTAVAA
FT                   MPTLVELAANHTLHGVLVATNFFGINTIPIALNEADYARMWTQAASTMATYQAVAEAAV
FT                   ASAPQTTPAPPILAAEAADDDHDHDHDHGGEPTPLDYLVAEILRIISGGRLIWDPAEGT
FT                   MNGIPFEDYTDAAQPIWWVVRAIEFSKDFETFVQELFVNPVEAFQFYFELLLFDYPTHI
FT                   VQIVEALSQSPQLLAVALGSVISNLGAVTGFAGLSGLAGMQPAAIPALAPVAAAPPTLP
FT                   AVAMAPTMAAPGAAVASAAAPASAPAASTVASATPAPPPAPGAAGFGYPYAIAPPGIGF
FT                   GSGMSASASAQRKAPQPDSAAAAAAAAAVRDQARARRRRRVTRRGYGDEFMDMNIDVDP
FT                   DWGPPPGEDPVTSTVASDRGAGHLGFAGTARREAVADAAGMTTLAGDDFGDGPTTPMVP
FT                   GSWDPDRDAPGSAEPGDRG"
     MTLWMASPPE VHSALLSSGP GPGSVLSAAG VWSSLSAEYA AVADELIGLL GAVQTGAWQG        60
     PSAAAYVAAH APYLAWLMRA SETSAEAAAR HETVAAAYTT AVAAMPTLVE LAANHTLHGV       120
     LVATNFFGIN TIPIALNEAD YARMWTQAAS TMATYQAVAE AAVASAPQTT PAPPILAAEA       180
     ADDDHDHDHD HGGEPTPLDY LVAEILRIIS GGRLIWDPAE GTMNGIPFED YTDAAQPIWW       240
     VVRAIEFSKD FETFVQELFV NPVEAFQFYF ELLLFDYPTH IVQIVEALSQ SPQLLAVALG       300
     SVISNLGAVT GFAGLSGLAG MQPAAIPALA PVAAAPPTLP AVAMAPTMAA PGAAVASAAA       360
     PASAPAASTV ASATPAPPPA PGAAGFGYPY AIAPPGIGFG SGMSASASAQ RKAPQPDSAA       420
     AAAAAAAVRD QARARRRRRV TRRGYGDEFM DMNIDVDPDW GPPPGEDPVT STVASDRGAG       480
     HLGFAGTARR EAVADAAGMT TLAGDDFGDG PTTPMVPGSW DPDRDAPGSA EPGDRG           536
//

If you have problems or comments...

PBIL Back to PBIL home page