(data stored in ACNUC7421 zone)

EMBL: CP001658.PE293

CP001658.PE293       Location/Qualifiers
FT   CDS             343865..344773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00286"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00286"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23314"
FT                   /protein_id="ACT23314.1"
FT                   /translation="MRTEGDSWDITTSVGSTALFVATARALEAQKSDPLVVDPYAEAFC
FT                   RAVGGSWADVLDGKLPDHKLKSTDFGEHFVNFQGARTKYFDEYFRRAAAAGARQVVILA
FT                   AGLDSRAYRLPWPDGTTVFELDRPQVLDFKREVLASHGAQPRALRREIAVDLRDDWPQA
FT                   LRDSGFDAAAPSAWIAEGLLIYLPATAQERLFTGIDALAGRRSHVAVEDGAPMGPDEYA
FT                   AKVEEERAAIAEGAEEHPFFQLVYNERCAPAAEWFGERGWTAVATLLNDYLEAVGRPVP
FT                   GPESEAGPMFARNTLVSAARV"
     MRTEGDSWDI TTSVGSTALF VATARALEAQ KSDPLVVDPY AEAFCRAVGG SWADVLDGKL        60
     PDHKLKSTDF GEHFVNFQGA RTKYFDEYFR RAAAAGARQV VILAAGLDSR AYRLPWPDGT       120
     TVFELDRPQV LDFKREVLAS HGAQPRALRR EIAVDLRDDW PQALRDSGFD AAAPSAWIAE       180
     GLLIYLPATA QERLFTGIDA LAGRRSHVAV EDGAPMGPDE YAAKVEEERA AIAEGAEEHP       240
     FFQLVYNERC APAAEWFGER GWTAVATLLN DYLEAVGRPV PGPESEAGPM FARNTLVSAA       300
     RV                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page