(data stored in ACNUC7421 zone)

EMBL: CP001658.PE294

CP001658.PE294       Location/Qualifiers
FT   CDS             344997..346892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00287"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00287"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23315"
FT                   /protein_id="ACT23315.1"
FT                   /translation="MAGVGEGDSGGVERDDIGMVAASPVASRVNGKVDADVVGRFATCC
FT                   RALGIAVYQRKRPPDLAAARSGFAALTRVAHDQCDAWTGLAAAGDQSIGVLEAASRTAT
FT                   TAGVLQRQVELADNALGFLYDTGLYLRFRATGPDDFHLAYAAALASTGGPEEFAKANHV
FT                   VSGITERRAGWRAARWLAVVINYRAERWSDVVKLLTPMVNDPDLDEAFSHAAKITLGTA
FT                   LARLGMFAPALSYLEEPDGPVAVAAVDGALAKALVLRAHVDEESASEVLQDLYAAHPEN
FT                   EQVEQALSDTSFGIVTTTAGRIEARTDPWDPATEPGAEDFVDPAAHERKAALLHEAELQ
FT                   LAEFIGLDEVKRQVSRLKSSVAMELVRKQRGLTVAQRTHHLVFAGPPGTGKTTIARVVA
FT                   KIYCGLGLLKRENIREVHRADLIGQHIGETEAKTNAIIDSALDGVLFLDEAYALVATGA
FT                   KNDFGLVAIDTLLARMENDRDRLVVIIAGYRADLDKFLDTNEGLRSRFTRNIDFPSYTS
FT                   HELVEIAHKMAEQRDSVFEQSALHDLEALFAKLAAESTPDTNGISRRSLDIAGNGRFVR
FT                   NIVERSEEEREFRLDHSEHAGSGEFSDEELMTITADDVGRSVEPLLRGLGLSVRA"
     MAGVGEGDSG GVERDDIGMV AASPVASRVN GKVDADVVGR FATCCRALGI AVYQRKRPPD        60
     LAAARSGFAA LTRVAHDQCD AWTGLAAAGD QSIGVLEAAS RTATTAGVLQ RQVELADNAL       120
     GFLYDTGLYL RFRATGPDDF HLAYAAALAS TGGPEEFAKA NHVVSGITER RAGWRAARWL       180
     AVVINYRAER WSDVVKLLTP MVNDPDLDEA FSHAAKITLG TALARLGMFA PALSYLEEPD       240
     GPVAVAAVDG ALAKALVLRA HVDEESASEV LQDLYAAHPE NEQVEQALSD TSFGIVTTTA       300
     GRIEARTDPW DPATEPGAED FVDPAAHERK AALLHEAELQ LAEFIGLDEV KRQVSRLKSS       360
     VAMELVRKQR GLTVAQRTHH LVFAGPPGTG KTTIARVVAK IYCGLGLLKR ENIREVHRAD       420
     LIGQHIGETE AKTNAIIDSA LDGVLFLDEA YALVATGAKN DFGLVAIDTL LARMENDRDR       480
     LVVIIAGYRA DLDKFLDTNE GLRSRFTRNI DFPSYTSHEL VEIAHKMAEQ RDSVFEQSAL       540
     HDLEALFAKL AAESTPDTNG ISRRSLDIAG NGRFVRNIVE RSEEEREFRL DHSEHAGSGE       600
     FSDEELMTIT ADDVGRSVEP LLRGLGLSVR A                                      631
//

If you have problems or comments...

PBIL Back to PBIL home page