(data stored in ACNUC7421 zone)

EMBL: CP001658.PE30

CP001658.PE30        Location/Qualifiers
FT   CDS             32159..33256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00029"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00029"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23051"
FT                   /protein_id="ACT23051.1"
FT                   /translation="MAIFGRWSARQRLRRATRESLTIPTFSSSLDCTTRVIGGLWPAEL
FT                   SSNTAETATLAEHLKADLHRIVGSANDELMVIWRAGMADSTRRAEEDRVIDRARASAMR
FT                   RVESAMRELRQITGRVPVEIPRMRGAGGSDLDTTRLMPAVTVVQPADQACTDWPVAAAE
FT                   DDEARLQRLLAFVARQEPRLNWAVGVHADGTTVLVTDVAHGWIPPGIALPEGVRLLAPA
FT                   RRAGRAPELVGITTCCKTYTPGDSLRRAVDSTAPTSSVQPRALPAIAGLSVELGIATQR
FT                   HDGLPKIVHAMATAAGNGAAAEEVDLLRVHVDTALHHVLAQYPRVDPALLLNCMLLAAT
FT                   ERSVTGDPIAANYHFAWFRELDSRR"
     MAIFGRWSAR QRLRRATRES LTIPTFSSSL DCTTRVIGGL WPAELSSNTA ETATLAEHLK        60
     ADLHRIVGSA NDELMVIWRA GMADSTRRAE EDRVIDRARA SAMRRVESAM RELRQITGRV       120
     PVEIPRMRGA GGSDLDTTRL MPAVTVVQPA DQACTDWPVA AAEDDEARLQ RLLAFVARQE       180
     PRLNWAVGVH ADGTTVLVTD VAHGWIPPGI ALPEGVRLLA PARRAGRAPE LVGITTCCKT       240
     YTPGDSLRRA VDSTAPTSSV QPRALPAIAG LSVELGIATQ RHDGLPKIVH AMATAAGNGA       300
     AAEEVDLLRV HVDTALHHVL AQYPRVDPAL LLNCMLLAAT ERSVTGDPIA ANYHFAWFRE       360
     LDSRR                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page