(data stored in ACNUC7421 zone)

EMBL: CP001658.PE300

CP001658.PE300       Location/Qualifiers
FT   CDS             354715..355005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00293"
FT                   /product="low molecular weight protein antigen 7 esxH"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00293"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23321"
FT                   /protein_id="ACT23321.1"
FT                   /translation="MSQIMYNYPAMLGHAGDMAGYAGTLQSLGAEIAVEQAALQSAWQG
FT                   DTGITYQAWQAQWNQAMEDLVRAYHAMSSTHEANTMAMMARDTAEAAKWGG"
     MSQIMYNYPA MLGHAGDMAG YAGTLQSLGA EIAVEQAALQ SAWQGDTGIT YQAWQAQWNQ        60
     AMEDLVRAYH AMSSTHEANT MAMMARDTAE AAKWGG                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page