(data stored in ACNUC7421 zone)

EMBL: CP001658.PE305

CP001658.PE305       Location/Qualifiers
FT   CDS             complement(359729..360931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00298"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00298"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23326"
FT                   /protein_id="ACT23326.1"
FT                   /translation="MSGTFTADAIGPPVPIPDVPGADAGAEGLPSRSVLSARQRILVES
FT                   SAIADVALRTAVASVLSATVTPAVVANALRHVNEGSERSNLNFYAELAAAHDPAKSFPA
FT                   PTELPKVTSRPASPLTEWVARGTVDNIAFASGFRAINPTMRQRWSALTANNIVHAQHWR
FT                   HRDGPRPTLCVIHGFMGSSYLLNGLFFSLPWYYRSGYDVLLYTLPFHGQRAEKFSPFSG
FT                   FGYFTSGLSGFAEAMAQAVYDFRSIVDYLRHIGVDRIALTGISLGGYTSALLASVESRL
FT                   EAVIPNCPVVMPAKLFDEWFPANKLVKLGLRLTNISRDELIAGLAYHGPLNYRPLLPKD
FT                   RRMIITGLGDRMAPPEHAVTLWKQWDRCALHWFPGSHLLHVSQLDYLRRMTVFLQGLMF
FT                   D"
     MSGTFTADAI GPPVPIPDVP GADAGAEGLP SRSVLSARQR ILVESSAIAD VALRTAVASV        60
     LSATVTPAVV ANALRHVNEG SERSNLNFYA ELAAAHDPAK SFPAPTELPK VTSRPASPLT       120
     EWVARGTVDN IAFASGFRAI NPTMRQRWSA LTANNIVHAQ HWRHRDGPRP TLCVIHGFMG       180
     SSYLLNGLFF SLPWYYRSGY DVLLYTLPFH GQRAEKFSPF SGFGYFTSGL SGFAEAMAQA       240
     VYDFRSIVDY LRHIGVDRIA LTGISLGGYT SALLASVESR LEAVIPNCPV VMPAKLFDEW       300
     FPANKLVKLG LRLTNISRDE LIAGLAYHGP LNYRPLLPKD RRMIITGLGD RMAPPEHAVT       360
     LWKQWDRCAL HWFPGSHLLH VSQLDYLRRM TVFLQGLMFD                             400
//

If you have problems or comments...

PBIL Back to PBIL home page