(data stored in ACNUC7421 zone)

EMBL: CP001658.PE316

CP001658.PE316       Location/Qualifiers
FT   CDS             complement(369007..378597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00309"
FT                   /product="PPE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00309"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23337"
FT                   /protein_id="ACT23337.1"
FT                   /translation="MDFVVSAPEVNSLRMYLGAGSGPMLAAAAAWDGLADELAVAASWF
FT                   GSVTSGLADAAWRGPAAVAMARAVAPYLGWLISATAQAEQAAAQARVAVATFEAARAAT
FT                   VHPAIVAANRAVLVSLVSSNLLGFNAPAIAATEAAYERMWAQDVAAMVGYHAGASAAVS
FT                   ALMPFTQQLKKLAGLSERLTSAAAAAAGPPSAAGFNLGLANVGANNVGNGNVGVFNVGF
FT                   GNLGSYNLGFANLGSDNLGLANLGGHNIGFANTGSNNVGFGNTGSNNVGIGLTGNGQIG
FT                   FGSFNSGSHNIGLFNSGSGNVGLFNSGTGNFGIGNSGTGNFGLGNTGSTNTGWFNTGDV
FT                   NTGGFNPGSYNTGNFNTGNYNTGSFNAGNYNTGYFNTGDYNTGVANTGNVNTGAFIAGN
FT                   YSNGVLWRGDYQGLIGADIALEIPAIPINAQLFSMPIHQVMVMPGSVMTIPGMRLPFTS
FT                   IVPFVVYYGPVELPQSTLTLPTVTITVGGPTTTIDGNLTGMVGGVSIPLIKIPAAPGFG
FT                   NSTTSPSSGFFNAGAGTASGFGNFGGGASGFWNLASATSGLSGFGNVGALGSGVANVGN
FT                   TISGLYNTSTSNLATPAFNSGLLHHSVGTMTLNFGLANVGGNNVGGANAGIFNVGLANL
FT                   GDYNIGFGNLGGDNLGFAHAGSYNIGFANTGSNNLGFANTGDNNIGFANIGSNNIGIGL
FT                   TGSGQIGFGSLNSGSHNIGLFNSGDGNIGLFNSGSGNFGIGNAGTGNWGIGNSGAGNFG
FT                   IGNAGSTNTGLFNSGDLNTGSLNPGSYNTGSVNTGSVNTGSVNTGSVNTGGFNAGNYNT
FT                   GYFNTGDYNTGMANTGNINTGAFISGNHSNGLLWRGDNQGLIDLAIGVDIPEIPIVSVD
FT                   VNIPIHIPITASFTDIVYSGLDLPPNTAVTVIFFGPVDIDPFTVPVIRITGPTPVVMVG
FT                   GPTTAINIGATVVVDAINIPIIHIPATPGFGNSTGGLSSGFFNSGAGSASGFGNFGGAA
FT                   SGFMNLVSTTSGMSGFLNVGALGSGVANVGNTISGIYNVGTSDLSTPAVNSGLANIGTN
FT                   IAGLLRDGAGTAAINLGLANHGNLNVGFASLGGFNFGGATIGHNNVGIGNTGIFDVGLA
FT                   NLGSYNIGFGNLGDDNLGFGNFGSYNIGFGNVGNDNLGFANAGGGNIGFANTGSNNVGF
FT                   GNTGSNNVGIGLTGNGQIGFGSFNSGSGNIGLFNSGSNNIGFFNSGSGNFGIANSGSFN
FT                   TGIGNTGNTNTGLFNSGDVNTGAFNPGSFNTGSFNTGSFNTGGFNPGNTNTGYLNIGNY
FT                   NTGIANTGDVDTGAFITGNYSNGLFLSGDYQGLVGLNLVIDMPLPISLGVNIPIDIPIT
FT                   ASAGNITLMGVTIPPTGDIVLSSIAGQRAHFGPITIPNITVVGPTTTVAIGGPNTAITI
FT                   TGGGAIRIPLISIPAAPGFGNSTTNPSSGFFNTGAGGASGFGNFGGANSGFWNLASATS
FT                   GASGLLNVGALGSGLANVGTTVSGFYNTSTSDLATPAFNSGLANISTSIAGLLRDSTGT
FT                   MVLNLGLANHGTLNVGIANLGDYNIGFANLGSANFGSANIGGNNIGGANTGIFDIGLAN
FT                   LGSYNIGFGNFGDDNLGFGNLGSYNVGFGNLGNDNLGFANTGSNNIGFANTGSNNIGIG
FT                   LTGDGQIGFGSLNSGSGNIGLFNSGSGNIGFFNSGNGNVGIGNTGTANFGLGNTGSTNT
FT                   GFFNSGDVNTGIGNTGSFNTGSFNPGDSNTGDFNPGSYNTGLGNTGDVDTGAFISGSYS
FT                   NGFLWSGNYQGLIGLHAALAIPEIALTFGVDIPIHIPINIDAGVVTLQGFSIVAAENNI
FT                   DFTPIIIPTINITLPTAAITVGGPTTSIGITASAGIGSITIPIIDIPATSGFGNSTTSP
FT                   SSGFFNSGAGSASGFLNVVAGASGISGYLNVGALGSGVTNVGHTVSGFYNASALDLVTP
FT                   AFASGLMRDGMGTMTLNLGLANLGSNNAGFGNTGIFDVGVANLGNYNIGFGNFGDDNLG
FT                   FANLGSYNIGVANTGSNNIGFANTGSNNIGIGLTGTGQIGIGALNSGSGNIGLFNSGDG
FT                   NIGFFNSGTGNFGIGNTGTGNFGIGNSGSTSTGLFNSGDGNTGGFNPGNFNTGNFNTGS
FT                   FNTGGFNAGNTNTGHFNTGNYNTGIANTGDVSTGAFISGNYSNGILWRGDYQGLIGYSY
FT                   ALTIPEIPAHLDVNIPIDIPITGSFTDLVVDNFTIPIIGFESFAFSFHIHTEPDIGPII
FT                   VPSFVLSVPTFAIAVGGPTTAINISATAGLGPITIPIIDIPAAPGIGNSTTSPSSGFFN
FT                   TGAGTASGFGNVGGNTSGLWNLASAASGVSGLLNVGALGSGVANVGNTISGIYNTSPLD
FT                   LGTPAFGSGLANIAGLLQGGAGTTILDLAGLGNLNVGLANLGGSNFGIGNTGIFNVGFA
FT                   NVGNHNIGLANLGNYSVGFANSGNYHIGIANTGSANIGFANTGSGNIGIGLTGTGQIGF
FT                   GSFNSGSHNIGLFNSGDGNVGFFNSGTGNVGIGNTGTANFGIANSGSFNTGLGNTGSTN
FT                   TGLFNPGNVNTGVGNTGSINTGSINTGSFNTGSTNTGSFNLGDHNTGSFNSGDYNTGYF
FT                   NAGDYNTGVANTGNVNTGAFISGNYSNGFFWRGDYQGLIGLSTTITIPEIPYRYDLSVP
FT                   IDIPITGTVVATTPNSFTIPGFQIRVLLGPAAVLVNEMIGPITIDVNQVIAIDSPIQQT
FT                   ISMVGTGGFGPIPIGISIGGTPGFGNSTTGPSSGFFHTGAGHVSGFGNFGAGNMSGSGN
FT                   FGAGNSGFFNAGGLGNSGLLNFGALQSGLANLGNTISGVYNTSTLDLATPAFGSGIANI
FT                   GANLAGLFLDNTGNLTLNFGVANQGGLNAGIGNLGSVNIGFVNTGDSNLGIGNLGDLNF
FT                   GGVNIGGNNIGIANTGIFDIGLANLGSYNIGLANLGDDNLGFGNAGSYNIGFANFGSDN
FT                   LGFANTGSYNIGFANTGNNNIGVGLTGNGQIGIGSLNSGSNNIGLFNSGSGNIGFFNSG
FT                   TGNVGIFNTGTGNFGLANSGGFNTGIGNAGSTNTGVFNPGDLNTGSFNPGSFNTGGFNP
FT                   GSGNTGYLNTGDYNTGVANTGDVDTGAFITGSYSNGFLVSGDYQGLIGLPLLGIPVTPG
FT                   YFNLTGGPSSGFFNSGAGSVSGFVNSGAGLSGYLNTGALGSGVANVGNTISGWLNASAL
FT                   DLATPGFLSGIGNFGTNLAGFFRG"
     MDFVVSAPEV NSLRMYLGAG SGPMLAAAAA WDGLADELAV AASWFGSVTS GLADAAWRGP        60
     AAVAMARAVA PYLGWLISAT AQAEQAAAQA RVAVATFEAA RAATVHPAIV AANRAVLVSL       120
     VSSNLLGFNA PAIAATEAAY ERMWAQDVAA MVGYHAGASA AVSALMPFTQ QLKKLAGLSE       180
     RLTSAAAAAA GPPSAAGFNL GLANVGANNV GNGNVGVFNV GFGNLGSYNL GFANLGSDNL       240
     GLANLGGHNI GFANTGSNNV GFGNTGSNNV GIGLTGNGQI GFGSFNSGSH NIGLFNSGSG       300
     NVGLFNSGTG NFGIGNSGTG NFGLGNTGST NTGWFNTGDV NTGGFNPGSY NTGNFNTGNY       360
     NTGSFNAGNY NTGYFNTGDY NTGVANTGNV NTGAFIAGNY SNGVLWRGDY QGLIGADIAL       420
     EIPAIPINAQ LFSMPIHQVM VMPGSVMTIP GMRLPFTSIV PFVVYYGPVE LPQSTLTLPT       480
     VTITVGGPTT TIDGNLTGMV GGVSIPLIKI PAAPGFGNST TSPSSGFFNA GAGTASGFGN       540
     FGGGASGFWN LASATSGLSG FGNVGALGSG VANVGNTISG LYNTSTSNLA TPAFNSGLLH       600
     HSVGTMTLNF GLANVGGNNV GGANAGIFNV GLANLGDYNI GFGNLGGDNL GFAHAGSYNI       660
     GFANTGSNNL GFANTGDNNI GFANIGSNNI GIGLTGSGQI GFGSLNSGSH NIGLFNSGDG       720
     NIGLFNSGSG NFGIGNAGTG NWGIGNSGAG NFGIGNAGST NTGLFNSGDL NTGSLNPGSY       780
     NTGSVNTGSV NTGSVNTGSV NTGGFNAGNY NTGYFNTGDY NTGMANTGNI NTGAFISGNH       840
     SNGLLWRGDN QGLIDLAIGV DIPEIPIVSV DVNIPIHIPI TASFTDIVYS GLDLPPNTAV       900
     TVIFFGPVDI DPFTVPVIRI TGPTPVVMVG GPTTAINIGA TVVVDAINIP IIHIPATPGF       960
     GNSTGGLSSG FFNSGAGSAS GFGNFGGAAS GFMNLVSTTS GMSGFLNVGA LGSGVANVGN      1020
     TISGIYNVGT SDLSTPAVNS GLANIGTNIA GLLRDGAGTA AINLGLANHG NLNVGFASLG      1080
     GFNFGGATIG HNNVGIGNTG IFDVGLANLG SYNIGFGNLG DDNLGFGNFG SYNIGFGNVG      1140
     NDNLGFANAG GGNIGFANTG SNNVGFGNTG SNNVGIGLTG NGQIGFGSFN SGSGNIGLFN      1200
     SGSNNIGFFN SGSGNFGIAN SGSFNTGIGN TGNTNTGLFN SGDVNTGAFN PGSFNTGSFN      1260
     TGSFNTGGFN PGNTNTGYLN IGNYNTGIAN TGDVDTGAFI TGNYSNGLFL SGDYQGLVGL      1320
     NLVIDMPLPI SLGVNIPIDI PITASAGNIT LMGVTIPPTG DIVLSSIAGQ RAHFGPITIP      1380
     NITVVGPTTT VAIGGPNTAI TITGGGAIRI PLISIPAAPG FGNSTTNPSS GFFNTGAGGA      1440
     SGFGNFGGAN SGFWNLASAT SGASGLLNVG ALGSGLANVG TTVSGFYNTS TSDLATPAFN      1500
     SGLANISTSI AGLLRDSTGT MVLNLGLANH GTLNVGIANL GDYNIGFANL GSANFGSANI      1560
     GGNNIGGANT GIFDIGLANL GSYNIGFGNF GDDNLGFGNL GSYNVGFGNL GNDNLGFANT      1620
     GSNNIGFANT GSNNIGIGLT GDGQIGFGSL NSGSGNIGLF NSGSGNIGFF NSGNGNVGIG      1680
     NTGTANFGLG NTGSTNTGFF NSGDVNTGIG NTGSFNTGSF NPGDSNTGDF NPGSYNTGLG      1740
     NTGDVDTGAF ISGSYSNGFL WSGNYQGLIG LHAALAIPEI ALTFGVDIPI HIPINIDAGV      1800
     VTLQGFSIVA AENNIDFTPI IIPTINITLP TAAITVGGPT TSIGITASAG IGSITIPIID      1860
     IPATSGFGNS TTSPSSGFFN SGAGSASGFL NVVAGASGIS GYLNVGALGS GVTNVGHTVS      1920
     GFYNASALDL VTPAFASGLM RDGMGTMTLN LGLANLGSNN AGFGNTGIFD VGVANLGNYN      1980
     IGFGNFGDDN LGFANLGSYN IGVANTGSNN IGFANTGSNN IGIGLTGTGQ IGIGALNSGS      2040
     GNIGLFNSGD GNIGFFNSGT GNFGIGNTGT GNFGIGNSGS TSTGLFNSGD GNTGGFNPGN      2100
     FNTGNFNTGS FNTGGFNAGN TNTGHFNTGN YNTGIANTGD VSTGAFISGN YSNGILWRGD      2160
     YQGLIGYSYA LTIPEIPAHL DVNIPIDIPI TGSFTDLVVD NFTIPIIGFE SFAFSFHIHT      2220
     EPDIGPIIVP SFVLSVPTFA IAVGGPTTAI NISATAGLGP ITIPIIDIPA APGIGNSTTS      2280
     PSSGFFNTGA GTASGFGNVG GNTSGLWNLA SAASGVSGLL NVGALGSGVA NVGNTISGIY      2340
     NTSPLDLGTP AFGSGLANIA GLLQGGAGTT ILDLAGLGNL NVGLANLGGS NFGIGNTGIF      2400
     NVGFANVGNH NIGLANLGNY SVGFANSGNY HIGIANTGSA NIGFANTGSG NIGIGLTGTG      2460
     QIGFGSFNSG SHNIGLFNSG DGNVGFFNSG TGNVGIGNTG TANFGIANSG SFNTGLGNTG      2520
     STNTGLFNPG NVNTGVGNTG SINTGSINTG SFNTGSTNTG SFNLGDHNTG SFNSGDYNTG      2580
     YFNAGDYNTG VANTGNVNTG AFISGNYSNG FFWRGDYQGL IGLSTTITIP EIPYRYDLSV      2640
     PIDIPITGTV VATTPNSFTI PGFQIRVLLG PAAVLVNEMI GPITIDVNQV IAIDSPIQQT      2700
     ISMVGTGGFG PIPIGISIGG TPGFGNSTTG PSSGFFHTGA GHVSGFGNFG AGNMSGSGNF      2760
     GAGNSGFFNA GGLGNSGLLN FGALQSGLAN LGNTISGVYN TSTLDLATPA FGSGIANIGA      2820
     NLAGLFLDNT GNLTLNFGVA NQGGLNAGIG NLGSVNIGFV NTGDSNLGIG NLGDLNFGGV      2880
     NIGGNNIGIA NTGIFDIGLA NLGSYNIGLA NLGDDNLGFG NAGSYNIGFA NFGSDNLGFA      2940
     NTGSYNIGFA NTGNNNIGVG LTGNGQIGIG SLNSGSNNIG LFNSGSGNIG FFNSGTGNVG      3000
     IFNTGTGNFG LANSGGFNTG IGNAGSTNTG VFNPGDLNTG SFNPGSFNTG GFNPGSGNTG      3060
     YLNTGDYNTG VANTGDVDTG AFITGSYSNG FLVSGDYQGL IGLPLLGIPV TPGYFNLTGG      3120
     PSSGFFNSGA GSVSGFVNSG AGLSGYLNTG ALGSGVANVG NTISGWLNAS ALDLATPGFL      3180
     SGIGNFGTNL AGFFRG                                                      3196
//

If you have problems or comments...

PBIL Back to PBIL home page