(data stored in ACNUC7421 zone)

EMBL: CP001658.PE319

CP001658.PE319       Location/Qualifiers
FT   CDS             379999..380715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00312"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00312"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23340"
FT                   /protein_id="ACT23340.1"
FT                   /translation="MTRPQALLAVSLAFVATAVYAVMWVGHSQDWGWLHSFDWSLLNAA
FT                   HDIGIKNPAWVRFWDGVSLILGPVVLRPLGLLAAMVALAKRKIRIALLLLACLPLNAIM
FT                   TIAAKSVAHRPRPATALVSAHSTSFPSGHALEATASVLALLTVLLPMLHSRFTRHIAIT
FT                   VGALCVLTVGVARVALNVHHPTDVVAGWALGYLYFLVCLCVFRPPSIFGAQRASHALSP
FT                   PVEVSRQPEPEVDTAR"
     MTRPQALLAV SLAFVATAVY AVMWVGHSQD WGWLHSFDWS LLNAAHDIGI KNPAWVRFWD        60
     GVSLILGPVV LRPLGLLAAM VALAKRKIRI ALLLLACLPL NAIMTIAAKS VAHRPRPATA       120
     LVSAHSTSFP SGHALEATAS VLALLTVLLP MLHSRFTRHI AITVGALCVL TVGVARVALN       180
     VHHPTDVVAG WALGYLYFLV CLCVFRPPSI FGAQRASHAL SPPVEVSRQP EPEVDTAR         238
//

If you have problems or comments...

PBIL Back to PBIL home page