(data stored in ACNUC7421 zone)

EMBL: CP001658.PE324

CP001658.PE324       Location/Qualifiers
FT   CDS             385376..385762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00317"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00317"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23345"
FT                   /protein_id="ACT23345.1"
FT                   /translation="MGDYGPFGFDPDEFDRVIREGSEGLRDAFERIGRFLSSSGAGTGW
FT                   SAIFEDLSRRSRPAPETAGEAGDGVWAIYTVDADGGARVEQVYATELDALRANKDNTDP
FT                   KRKVRFLPYGIAVSVLDDPVDEAQ"
     MGDYGPFGFD PDEFDRVIRE GSEGLRDAFE RIGRFLSSSG AGTGWSAIFE DLSRRSRPAP        60
     ETAGEAGDGV WAIYTVDADG GARVEQVYAT ELDALRANKD NTDPKRKVRF LPYGIAVSVL       120
     DDPVDEAQ                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page