(data stored in ACNUC7421 zone)

EMBL: CP001658.PE325

CP001658.PE325       Location/Qualifiers
FT   CDS             complement(385765..386427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00318"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00318"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23346"
FT                   /protein_id="ACT23346.1"
FT                   /translation="MIVVWEHLCMNPEDDPEARIRELERPLADVARASELGGSQSGGYT
FT                   YPPGPPPPPYSYGGPFGGPSPRSSSGNRAWWILAAVVVVGVLVLVGGIAAFSAQRLSQG
FT                   NFVVLSPTPSVSRAVPTPTAQPATTLPPAGASLSVSGVNVNRTIACNDSIVSVSGMSNT
FT                   VVITGHCTSLTVSGMRNSVTVDSVDTIEAAGFNNEVTYHSGSPKISNAGGSNSVQQG"
     MIVVWEHLCM NPEDDPEARI RELERPLADV ARASELGGSQ SGGYTYPPGP PPPPYSYGGP        60
     FGGPSPRSSS GNRAWWILAA VVVVGVLVLV GGIAAFSAQR LSQGNFVVLS PTPSVSRAVP       120
     TPTAQPATTL PPAGASLSVS GVNVNRTIAC NDSIVSVSGM SNTVVITGHC TSLTVSGMRN       180
     SVTVDSVDTI EAAGFNNEVT YHSGSPKISN AGGSNSVQQG                             220
//

If you have problems or comments...

PBIL Back to PBIL home page