(data stored in ACNUC7421 zone)

EMBL: CP001658.PE331

CP001658.PE331       Location/Qualifiers
FT   CDS             390774..391436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00324"
FT                   /product="hypothetical exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00324"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23352"
FT                   /protein_id="ACT23352.1"
FT                   /translation="MGRHELARDRRKSSAVLAAVLAPAAVFFATGGDVSTLAARADANP
FT                   VLGDDAPCCVQIVPVAPLAFSSQISGGEIGTGLAASQFASASRWRIVSRYLPVGVAPEQ
FT                   GLQVKTVLTARSISAAFPEIREIGGVRPDALRWHPNGLALDVMVPNPGTAEGIALGNEI
FT                   VAFVLKNATRFGMQDVIWRGAYYTPNGARTTGAGHYDHIHITTVGGGYPTGEELYIR"
     MGRHELARDR RKSSAVLAAV LAPAAVFFAT GGDVSTLAAR ADANPVLGDD APCCVQIVPV        60
     APLAFSSQIS GGEIGTGLAA SQFASASRWR IVSRYLPVGV APEQGLQVKT VLTARSISAA       120
     FPEIREIGGV RPDALRWHPN GLALDVMVPN PGTAEGIALG NEIVAFVLKN ATRFGMQDVI       180
     WRGAYYTPNG ARTTGAGHYD HIHITTVGGG YPTGEELYIR                             220
//

If you have problems or comments...

PBIL Back to PBIL home page