(data stored in ACNUC7421 zone)

EMBL: CP001658.PE334

CP001658.PE334       Location/Qualifiers
FT   CDS             complement(393466..394137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00327"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00327"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23355"
FT                   /protein_id="ACT23355.1"
FT                   /translation="MNSCNRLPCAHEVLAVFAHPDDESFGLGAVLGDFTAQGTRLRGLC
FT                   FTHGEASTLGRTDRNLGEVRREELAAAAQVLGVDHVQLLAYPDNGLAQIPLNELTQRVV
FT                   DALAGADLLLVFDDNGVTGHPDHRRATEAALAAASTPGIPVLAWALPQPIADRLNAEFS
FT                   ASFGGRGHGHLDIMIEVDRSRQLAAIGCHFTQSADNPVLWRRLELLGDREYLRWLRRSV
FT                   P"
     MNSCNRLPCA HEVLAVFAHP DDESFGLGAV LGDFTAQGTR LRGLCFTHGE ASTLGRTDRN        60
     LGEVRREELA AAAQVLGVDH VQLLAYPDNG LAQIPLNELT QRVVDALAGA DLLLVFDDNG       120
     VTGHPDHRRA TEAALAAAST PGIPVLAWAL PQPIADRLNA EFSASFGGRG HGHLDIMIEV       180
     DRSRQLAAIG CHFTQSADNP VLWRRLELLG DREYLRWLRR SVP                         223
//

If you have problems or comments...

PBIL Back to PBIL home page