(data stored in ACNUC7421 zone)

EMBL: CP001658.PE337

CP001658.PE337       Location/Qualifiers
FT   CDS             395159..395614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00330"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23358"
FT                   /protein_id="ACT23358.1"
FT                   /translation="MVATDFSDVAVAQLRRSAQARGVSARVQPIVHDLRQPLPVKTGSI
FT                   DGAFAHMALCMALSTSEIHAVVAEVGRVLRPGGKFIYTVRHTGDAHYGAGQAHGDDIFE
FT                   CAGFAVHFFRRELVARLATGWVLEEVHDFEEGELPRRLWRVTVTKPA"
     MVATDFSDVA VAQLRRSAQA RGVSARVQPI VHDLRQPLPV KTGSIDGAFA HMALCMALST        60
     SEIHAVVAEV GRVLRPGGKF IYTVRHTGDA HYGAGQAHGD DIFECAGFAV HFFRRELVAR       120
     LATGWVLEEV HDFEEGELPR RLWRVTVTKP A                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page