(data stored in ACNUC7421 zone)

EMBL: CP001658.PE343

CP001658.PE343       Location/Qualifiers
FT   CDS             400328..401113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00336"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00336"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23364"
FT                   /protein_id="ACT23364.1"
FT                   /translation="MRKPASSLAKVDYSSAYLEQTHAFGELIRNVDQSTPVPTCPGWSL
FT                   GQLFRHVGRGDRWAAQIVRDRLDHFLDPRSVEGGKPPPDPDDAISWLYGGARLLVDAVE
FT                   QTGVETPVWTFLGPRPAGWWVRRRLHEVAVHRADVAITVGGEFTLEPNVAADGISEFLE
FT                   RIAVQAGSGGTPLPLEDDDTLHLHATDPGLLEAGEWTVRRDERGVTWSHRHGKGAVALR
FT                   GGATELLLAMVRRLSVADTGIELLGDAGVWQKWLDRTPL"
     MRKPASSLAK VDYSSAYLEQ THAFGELIRN VDQSTPVPTC PGWSLGQLFR HVGRGDRWAA        60
     QIVRDRLDHF LDPRSVEGGK PPPDPDDAIS WLYGGARLLV DAVEQTGVET PVWTFLGPRP       120
     AGWWVRRRLH EVAVHRADVA ITVGGEFTLE PNVAADGISE FLERIAVQAG SGGTPLPLED       180
     DDTLHLHATD PGLLEAGEWT VRRDERGVTW SHRHGKGAVA LRGGATELLL AMVRRLSVAD       240
     TGIELLGDAG VWQKWLDRTP L                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page