(data stored in ACNUC7421 zone)

EMBL: CP001658.PE347

CP001658.PE347       Location/Qualifiers
FT   CDS             403054..404589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00340"
FT                   /product="13E12 repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00340"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23368"
FT                   /protein_id="ACT23368.1"
FT                   /translation="MFDQVRGRMPSPEAIAHFDERFECHAPRTTRVSAAFIDRICSATR
FT                   AENRAAAAQLVALGELFAYRWSRCGGREEWVMDTMAAVAAEVAAALRISQGLAASRLRY
FT                   ARAMRERLPKTAEVFSAGDIGYLMFATIVYRTDLIVDPDVLAAVDAQLAANVARWPSMT
FT                   KARLAGQVDKIVARADADAVRRRKEYQAQRQFWVGESQDGVCQIGGSLLAVDAHALDAR
FT                   LSALAGTVCEHDPRSREQRRADALGALAGGADRLGCGCGRADCAAGKRPAAPPVVIHLI
FT                   AEAATINGTGSAPASQMNADGLITAELVAELAKTATLVPLVHPGDAPPEPGYAPSKALA
FT                   DFVRCRDLTCRWPGCDEPATNCDLDHTIPYAAGGPTHASNLKCYCRTHHLVKTFWGWRD
FT                   QQLPDGTLILTSPSGHTYVSTPGSALLFPSLCHFSGGIPAPEADPPYDHCDQRTAMMPK
FT                   RRRTRAQDRAYRIATERRQNHAARQRAQVLTQTAAATDTHGPPPDPNDDPPPF"
     MFDQVRGRMP SPEAIAHFDE RFECHAPRTT RVSAAFIDRI CSATRAENRA AAAQLVALGE        60
     LFAYRWSRCG GREEWVMDTM AAVAAEVAAA LRISQGLAAS RLRYARAMRE RLPKTAEVFS       120
     AGDIGYLMFA TIVYRTDLIV DPDVLAAVDA QLAANVARWP SMTKARLAGQ VDKIVARADA       180
     DAVRRRKEYQ AQRQFWVGES QDGVCQIGGS LLAVDAHALD ARLSALAGTV CEHDPRSREQ       240
     RRADALGALA GGADRLGCGC GRADCAAGKR PAAPPVVIHL IAEAATINGT GSAPASQMNA       300
     DGLITAELVA ELAKTATLVP LVHPGDAPPE PGYAPSKALA DFVRCRDLTC RWPGCDEPAT       360
     NCDLDHTIPY AAGGPTHASN LKCYCRTHHL VKTFWGWRDQ QLPDGTLILT SPSGHTYVST       420
     PGSALLFPSL CHFSGGIPAP EADPPYDHCD QRTAMMPKRR RTRAQDRAYR IATERRQNHA       480
     ARQRAQVLTQ TAAATDTHGP PPDPNDDPPP F                                      511
//

If you have problems or comments...

PBIL Back to PBIL home page