(data stored in ACNUC7421 zone)

EMBL: CP001658.PE351

CP001658.PE351       Location/Qualifiers
FT   CDS             411520..412059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00344"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00344"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23372"
FT                   /protein_id="ACT23372.1"
FT                   /translation="MANSLLDFVISLVRDPEAAARYAANPERSIAEAHLTDVTRADVNS
FT                   LIPVVSDSLSMSEPIGAAGGAHAGDRGNVWASGAATAALDAFAPHADAGVVQQHGAVGS
FT                   VLNQPTPPGPGVTPTDPRPFRAGPHETSALLTSAEIPDTTSEDGGLPTDHPAVWNHPVV
FT                   DPHTVEPDHHGYDIHG"
     MANSLLDFVI SLVRDPEAAA RYAANPERSI AEAHLTDVTR ADVNSLIPVV SDSLSMSEPI        60
     GAAGGAHAGD RGNVWASGAA TAALDAFAPH ADAGVVQQHG AVGSVLNQPT PPGPGVTPTD       120
     PRPFRAGPHE TSALLTSAEI PDTTSEDGGL PTDHPAVWNH PVVDPHTVEP DHHGYDIHG        179
//

If you have problems or comments...

PBIL Back to PBIL home page