(data stored in ACNUC7421 zone)

EMBL: CP001658.PE354

CP001658.PE354       Location/Qualifiers
FT   CDS             415643..417124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00347"
FT                   /product="isoniazid inductible protein iniC"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00347"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23375"
FT                   /protein_id="ACT23375.1"
FT                   /translation="MSTSDRVRAILHATIQAYRGAPAYRQRGDVFCQLDRIGARLAEPL
FT                   RIALAGTLKAGKSTLVNALVGDDIAPTDATEATRIVTWFRHGPTPRVTANHRGGRRANV
FT                   PITRRGGLSFDLRRINPAELIDLEVEWPAEELIDATIVDTPGTSSLACDASERTLRLLV
FT                   PADGVPRVDAVVFLLRTLNAADVALLKQIGGLVGGSVGALGIIGVASRADEIGAGRIDA
FT                   MLSANDVAKRFTRELNQMGICQAVVPVSGLLALTARTLRQTEFIALRKLAGAERTELNR
FT                   ALLSVDRFVRRDSPLPVDAGIRAQLLERFGMFGIRMSIAVLAAGVTDSTGLAAELLERS
FT                   GLVALRNVIDQQFAQRSDMLKAHTALVSLRRFVQTHPVPATPYVIADIDPLLADTHAFE
FT                   ELRMLSLLPSRATTLNDDEIASLRRIIGGSGTSAAARLGLDPANSREAPRAALAAAQHW
FT                   RRRAAHPLNDPFTTRACRAAVRSAEAMVAEFSARR"
     MSTSDRVRAI LHATIQAYRG APAYRQRGDV FCQLDRIGAR LAEPLRIALA GTLKAGKSTL        60
     VNALVGDDIA PTDATEATRI VTWFRHGPTP RVTANHRGGR RANVPITRRG GLSFDLRRIN       120
     PAELIDLEVE WPAEELIDAT IVDTPGTSSL ACDASERTLR LLVPADGVPR VDAVVFLLRT       180
     LNAADVALLK QIGGLVGGSV GALGIIGVAS RADEIGAGRI DAMLSANDVA KRFTRELNQM       240
     GICQAVVPVS GLLALTARTL RQTEFIALRK LAGAERTELN RALLSVDRFV RRDSPLPVDA       300
     GIRAQLLERF GMFGIRMSIA VLAAGVTDST GLAAELLERS GLVALRNVID QQFAQRSDML       360
     KAHTALVSLR RFVQTHPVPA TPYVIADIDP LLADTHAFEE LRMLSLLPSR ATTLNDDEIA       420
     SLRRIIGGSG TSAAARLGLD PANSREAPRA ALAAAQHWRR RAAHPLNDPF TTRACRAAVR       480
     SAEAMVAEFS ARR                                                          493
//

If you have problems or comments...

PBIL Back to PBIL home page