(data stored in ACNUC7421 zone)

EMBL: CP001658.PE356

CP001658.PE356       Location/Qualifiers
FT   CDS             417930..418346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00349"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00349"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23377"
FT                   /protein_id="ACT23377.1"
FT                   /translation="MALLPSTVVGVLLAAGAGRWYGKPKVLVDGWLDTAVGALRDGGCN
FT                   DVILVLGAVEVSAPAGVTAITAPDWQQGLSASVRAGLAQADREHADYAVLHVIDTPDVN
FT                   AKVVARVLGRALVSRSGLAGRGRIPAHSARRRGC"
     MALLPSTVVG VLLAAGAGRW YGKPKVLVDG WLDTAVGALR DGGCNDVILV LGAVEVSAPA        60
     GVTAITAPDW QQGLSASVRA GLAQADREHA DYAVLHVIDT PDVNAKVVAR VLGRALVSRS       120
     GLAGRGRIPA HSARRRGC                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page