(data stored in ACNUC7421 zone)

EMBL: CP001658.PE358

CP001658.PE358       Location/Qualifiers
FT   CDS             420190..421176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00351"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00351"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23379"
FT                   /protein_id="ACT23379.1"
FT                   /translation="MPGARELTLRVERGALFRRRWAASAASSARAAIRRDPRRCALGTR
FT                   PRWVSFLVIVLVIMNVVTAHPKYPNDPLALVLIELRHPRTEPPVPSAISILKEELARWT
FT                   PILEQEEVRQVNLETGEHTAHSQKKLVARDRRTAITFRPDAMTLEVTDYPGWEEFRSIV
FT                   HAMVTARQDVAPVDGCIRIGLRYINEIRASLAEPSGWAYWVAESLLGPGTQLADLKLTT
FT                   TAQRHVIQCEGPEPGDSLTLRYAGARGAVIQSTPFLQRLKEPPAEGDFFLIDIDSAWSD
FT                   PCKGIPALDAHLVDEVAERLHTPIGPLFESLITSELRTKVLQQPGQE"
     MPGARELTLR VERGALFRRR WAASAASSAR AAIRRDPRRC ALGTRPRWVS FLVIVLVIMN        60
     VVTAHPKYPN DPLALVLIEL RHPRTEPPVP SAISILKEEL ARWTPILEQE EVRQVNLETG       120
     EHTAHSQKKL VARDRRTAIT FRPDAMTLEV TDYPGWEEFR SIVHAMVTAR QDVAPVDGCI       180
     RIGLRYINEI RASLAEPSGW AYWVAESLLG PGTQLADLKL TTTAQRHVIQ CEGPEPGDSL       240
     TLRYAGARGA VIQSTPFLQR LKEPPAEGDF FLIDIDSAWS DPCKGIPALD AHLVDEVAER       300
     LHTPIGPLFE SLITSELRTK VLQQPGQE                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page