(data stored in ACNUC7421 zone)

EMBL: CP001658.PE365

CP001658.PE365       Location/Qualifiers
FT   CDS             complement(427081..427632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00358"
FT                   /product="PPE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00358"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23386"
FT                   /protein_id="ACT23386.1"
FT                   /translation="MSVCVIYIPFKGCVKHVSVTIPITTEHLGPYEIDASTINPDQPID
FT                   TAFTQTLDFAGSGTVGAFPFGFGWQQSPGFFNSTTTPSSGFFNSGAGGASGFLNDAAAA
FT                   VSGLGNVFTETSGFFNAGGVGNSGFQNFGNLLSGWANLGNTVSGFYNTSMLDLATQALI
FT                   SGFGNHGARLSGILNNGSGP"
     MSVCVIYIPF KGCVKHVSVT IPITTEHLGP YEIDASTINP DQPIDTAFTQ TLDFAGSGTV        60
     GAFPFGFGWQ QSPGFFNSTT TPSSGFFNSG AGGASGFLND AAAAVSGLGN VFTETSGFFN       120
     AGGVGNSGFQ NFGNLLSGWA NLGNTVSGFY NTSMLDLATQ ALISGFGNHG ARLSGILNNG       180
     SGP                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page