(data stored in ACNUC7421 zone)

EMBL: CP001658.PE366

CP001658.PE366       Location/Qualifiers
FT   CDS             complement(427715..437542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00359"
FT                   /product="PPE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00359"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23387"
FT                   /protein_id="ACT23387.1"
FT                   /translation="MSFAVLPPEINSARLYVGAGLAPMLDAAAAWDGLADELGSAAASF
FT                   SAVTAGLAGSSWLGAASTAMTGAAAPYLGWLSAAAAQAQQAATQTRLAAAAFEAALAAT
FT                   VHPAIISANRALFVSLVVSNLLGQNAPAIAATEAAYEQMWAQDVAAMFGYHAGASAAVS
FT                   ALTPFGQALPTVAGGGALVSAAAAQVTTRVFRNLGLANVGEGNVGNGNVGNFNLGSANI
FT                   GNGNIGSGNIGSSNIGFGNVGPGLTAALNNIGFGNTGSNNIGFGNTGSNNIGFGNTGDG
FT                   NRGIGLTGSGLLGFGGLNSGTGNIGLFNSGTGNVGIGNSGTGNWGIGNSGNSYNTGFGN
FT                   SGDANTGFFNSGIANTGVGNAGNYNTGSYNPGNSNTGGFNMGQYNTGYLNSGNYNTGLA
FT                   NSGNVNTGAFITGNFNNGFLWRGDHQGLIFGSPGFFNSTSAPSSGFFNSGAGSASGFLN
FT                   SGANNSGFFNSSSGAIGNSGLANAGVLVSGVINSGNTVSGLFNMSLVAITTPALISGFF
FT                   NTGSNMSGFFGGPPVFNLGLANRGVVNILGNANIGNYNILGSGNVGDFNILGSGNLGSQ
FT                   NILGSGNVGSFNIGSGNIGVFNVGSGSLGNYNIGSGNLGIYNIGFGNVGDYNVGFGNAG
FT                   DFNQGFANTGNNNIGFANTGNNNIGIGLSGDNQQGFNIASGWNSGTGNSGLFNSGTNNV
FT                   GIFNAGTGNVGIANSGTGNWGIGNPGTDNTGILNAGSYNTGILNAGDFNTGFYNTGSYN
FT                   TGGFNVGNTNTGNFNVGDTNTGSYNPGDTNTGFFNPGNVNTGAFDTGDFNNGFLVAGDN
FT                   QGQIAIDLSVTTPFIPINEQMVIDVHNVMTFGGNMITVTEASTVFPQTFYLSGLFFFGP
FT                   VNLSASTLTVPTITLTIGGPTVTVPISIVGALESRTITFLKIDPAPGIGNSTTNPSSGF
FT                   FNSGTGGTSGFQNVGGGSSGVWNSGLSSAIGNSGFQNLGSLQSGWANLGNSVSGFFNTS
FT                   TVNLSTPANVSGLNNIGTNLSGVFRGPTGTIFNAGLANLGQLNIGSANLGDFNLGSGNV
FT                   GSFNVFSGNQGSYNIGPANLGNYNIGFANLGNYNIGFGNAGDFNQGFANTGNNNIGFAN
FT                   TGNNNIGIGLSGDNQQGFNFAGGWNSGTANIGLFNSGTNNVGIGNSGTGNWGIGNSGSG
FT                   NTGIGNTGSTNTGFFNTGIVNTGVANAGSYNTGWYNTGDTNTGIANLGDFNTGFYNTGN
FT                   FSTGFANQGDIATGAFITGDMGNGAFWRGDQQGLFSAGYRVHVPEIPAHVTVEVPVNIP
FT                   ITASFTNTVYSGITLEQINFGFTIDIAGIPLLAGAISKAVLPPITGTGPAITVNIGDPG
FT                   GSTAIRIPATASVGPFDVTFVNIAATTGFFNATTDPSSGFFNGGPGTVSGIANIGANIS
FT                   GFQNVANSATSGFNNYGSLQSGLANLGDTVSGVFNTGIGAPANVSGMFNIGSNLAGFFH
FT                   DQATGMSMFNLGLGNIGQFNVGFSNVGDSNAGLANIGSFNLGSGNLGSFNVFGGNQGSY
FT                   NIGPANLGNYNIGLGNLGSYNFGFGNAGDFNLGFANTGNNNIGFANTGNNNIGIGLSGD
FT                   NQQGFNFAGGWNSGSGNSGLFNSGTNNIGLFNSGTGNIGIGNSGTGNWGIANTGDTNTG
FT                   IFNTGDVNTGLLNAGNVNTGIFNTGHYNTGSFNAGSFNTAGFNPGSYNTGYLNTGSYNT
FT                   GLANSGDVNTGGFITGNYSNGFWWRGDYQGLAGISQTITVPDTAVPVKLHVPIFLDIPV
FT                   TGTLGTFTVHGFRFPEITGDIFLIGIPFNAATLDAFSFPNISIVLPNIGINLGSGPDPL
FT                   IDIAGTGGLLPIKIPLIDIPAAPGFGNSTTTPSSGFFNAGTGTVSGVGNVGSNSSGFFN
FT                   LTSGSSGISGVQNFGELISGGFNFGNTVSGLVNASTLGLSMPANLSGGGNVGATVAGFV
FT                   NNTQILNLGFGNVGSGNVGHGNIGDSNVGLGNLGNANVGHGNIGSFNVFSGNRGSYNIG
FT                   PANLGNYNIGLGNLGSYNFGFGNAGDFNLGFANSGSNNIGFANTGNNNIGIGLSGHNQQ
FT                   GFGSWNSGTANTGLFNSGTNNIGLFNSGTGNIGIGNSGIGNTGIGNPGVGNTGLGNSGT
FT                   GNWGLWNPGTGNMGVANVGTYNTGGYNVGSTNTGIANVGIANTGSYNTGSTNTGSFNDG
FT                   DFNTGFYNTGDYNTGFYNTGDVNTGAFIGGNFSNGAFWQSDHQGQWGAHYAITVPQIPL
FT                   LNFSLNIPVNIPIHLDFGTLAVNGFQIPAITLRALGVTHFSVGPIIVPRIAGTLPVIDI
FT                   NIGDPGGSSSIPITITSGAGPVVIPLLDIPPAPGFGNSTTGPSSGFFNSGTGSSSGFGN
FT                   VGANNSGFWNTAFAGIGNSGLQNFGSLQSGWANLGNTVSGFYNTSAADFATPANLSGLS
FT                   NVGADLTGVLRGPNGSTFNAGLANLGQFNVGSANLGSANLGSANLGNSNVGFGNIGNAN
FT                   IGGANIGDFNVGIANTGPGLTAAVNNIGIGNTGNYNIGVGNTGNYNIGFGNTGNNNIGI
FT                   GLSGDNQIGFGPLNAGIANMGLFNLGDNNFGMANAGNFNQGIANTGNNNIGLFNTGNNN
FT                   VGIGLTGDGLSGFSSLNSGAGNTGFFNSGTANTGLFNSGTGNTGLFNSGTGNVGIGNMG
FT                   TGGFGVGLSGDSQVGIGGTNSGSFNIGLFNSGTGNVGIGNSGTGNVGIGNTGTGNTGIG
FT                   NSGNYNTGLLNAGLVNTGIANPGNHNTGLFNIGTFNTGIANPGHYNTGSYNTGSYNTGM
FT                   ANAGDYGTGAFITGSMNNGLLWRADRQGLLAANYTITIERPAAFLNVDIPVNIPITGDI
FT                   TNVSIPAITFPRIDASGSVDIGILSGTVLAPVGPITLHGGDASAPLDTPIEIDFGPSPA
FT                   INLNIGKPDGSTVINIVGGAGAGPISIPIIDLRPAPGFFNATTGPSSGFLNWGAGSASG
FT                   LLNFGNNSGLYNFATSSMGNSGFQNYGSLQSGWANLGNSISGIYNTGLGAPANVSGLLN
FT                   IGTNLAGWLQNGPTETTFSVGLANLGFWNLGSANIGNYNLGSANIGVYNLGSANIGDFN
FT                   LGSANIGDFNLGSANIGSSNIGFGNVGPGLTAAIGNIGFGNTGNGNIGIGLTGDTMTGF
FT                   GGWNSGTGNIGLFNSGTGNIGFGNSGTGNWGIGNSGDYNTGIGNTGSTNSGFFNTGLVN
FT                   TGIGNSGDYNTGLFNAGNTNTGSFNPGDYNTGGFNPGNYNTGYFNPGNSNTGIANSGDV
FT                   NTGAFNSGNYSNGFFWRGDYQGLGGFAYQSAVSEIPWSYDRFQH"
     MSFAVLPPEI NSARLYVGAG LAPMLDAAAA WDGLADELGS AAASFSAVTA GLAGSSWLGA        60
     ASTAMTGAAA PYLGWLSAAA AQAQQAATQT RLAAAAFEAA LAATVHPAII SANRALFVSL       120
     VVSNLLGQNA PAIAATEAAY EQMWAQDVAA MFGYHAGASA AVSALTPFGQ ALPTVAGGGA       180
     LVSAAAAQVT TRVFRNLGLA NVGEGNVGNG NVGNFNLGSA NIGNGNIGSG NIGSSNIGFG       240
     NVGPGLTAAL NNIGFGNTGS NNIGFGNTGS NNIGFGNTGD GNRGIGLTGS GLLGFGGLNS       300
     GTGNIGLFNS GTGNVGIGNS GTGNWGIGNS GNSYNTGFGN SGDANTGFFN SGIANTGVGN       360
     AGNYNTGSYN PGNSNTGGFN MGQYNTGYLN SGNYNTGLAN SGNVNTGAFI TGNFNNGFLW       420
     RGDHQGLIFG SPGFFNSTSA PSSGFFNSGA GSASGFLNSG ANNSGFFNSS SGAIGNSGLA       480
     NAGVLVSGVI NSGNTVSGLF NMSLVAITTP ALISGFFNTG SNMSGFFGGP PVFNLGLANR       540
     GVVNILGNAN IGNYNILGSG NVGDFNILGS GNLGSQNILG SGNVGSFNIG SGNIGVFNVG       600
     SGSLGNYNIG SGNLGIYNIG FGNVGDYNVG FGNAGDFNQG FANTGNNNIG FANTGNNNIG       660
     IGLSGDNQQG FNIASGWNSG TGNSGLFNSG TNNVGIFNAG TGNVGIANSG TGNWGIGNPG       720
     TDNTGILNAG SYNTGILNAG DFNTGFYNTG SYNTGGFNVG NTNTGNFNVG DTNTGSYNPG       780
     DTNTGFFNPG NVNTGAFDTG DFNNGFLVAG DNQGQIAIDL SVTTPFIPIN EQMVIDVHNV       840
     MTFGGNMITV TEASTVFPQT FYLSGLFFFG PVNLSASTLT VPTITLTIGG PTVTVPISIV       900
     GALESRTITF LKIDPAPGIG NSTTNPSSGF FNSGTGGTSG FQNVGGGSSG VWNSGLSSAI       960
     GNSGFQNLGS LQSGWANLGN SVSGFFNTST VNLSTPANVS GLNNIGTNLS GVFRGPTGTI      1020
     FNAGLANLGQ LNIGSANLGD FNLGSGNVGS FNVFSGNQGS YNIGPANLGN YNIGFANLGN      1080
     YNIGFGNAGD FNQGFANTGN NNIGFANTGN NNIGIGLSGD NQQGFNFAGG WNSGTANIGL      1140
     FNSGTNNVGI GNSGTGNWGI GNSGSGNTGI GNTGSTNTGF FNTGIVNTGV ANAGSYNTGW      1200
     YNTGDTNTGI ANLGDFNTGF YNTGNFSTGF ANQGDIATGA FITGDMGNGA FWRGDQQGLF      1260
     SAGYRVHVPE IPAHVTVEVP VNIPITASFT NTVYSGITLE QINFGFTIDI AGIPLLAGAI      1320
     SKAVLPPITG TGPAITVNIG DPGGSTAIRI PATASVGPFD VTFVNIAATT GFFNATTDPS      1380
     SGFFNGGPGT VSGIANIGAN ISGFQNVANS ATSGFNNYGS LQSGLANLGD TVSGVFNTGI      1440
     GAPANVSGMF NIGSNLAGFF HDQATGMSMF NLGLGNIGQF NVGFSNVGDS NAGLANIGSF      1500
     NLGSGNLGSF NVFGGNQGSY NIGPANLGNY NIGLGNLGSY NFGFGNAGDF NLGFANTGNN      1560
     NIGFANTGNN NIGIGLSGDN QQGFNFAGGW NSGSGNSGLF NSGTNNIGLF NSGTGNIGIG      1620
     NSGTGNWGIA NTGDTNTGIF NTGDVNTGLL NAGNVNTGIF NTGHYNTGSF NAGSFNTAGF      1680
     NPGSYNTGYL NTGSYNTGLA NSGDVNTGGF ITGNYSNGFW WRGDYQGLAG ISQTITVPDT      1740
     AVPVKLHVPI FLDIPVTGTL GTFTVHGFRF PEITGDIFLI GIPFNAATLD AFSFPNISIV      1800
     LPNIGINLGS GPDPLIDIAG TGGLLPIKIP LIDIPAAPGF GNSTTTPSSG FFNAGTGTVS      1860
     GVGNVGSNSS GFFNLTSGSS GISGVQNFGE LISGGFNFGN TVSGLVNAST LGLSMPANLS      1920
     GGGNVGATVA GFVNNTQILN LGFGNVGSGN VGHGNIGDSN VGLGNLGNAN VGHGNIGSFN      1980
     VFSGNRGSYN IGPANLGNYN IGLGNLGSYN FGFGNAGDFN LGFANSGSNN IGFANTGNNN      2040
     IGIGLSGHNQ QGFGSWNSGT ANTGLFNSGT NNIGLFNSGT GNIGIGNSGI GNTGIGNPGV      2100
     GNTGLGNSGT GNWGLWNPGT GNMGVANVGT YNTGGYNVGS TNTGIANVGI ANTGSYNTGS      2160
     TNTGSFNDGD FNTGFYNTGD YNTGFYNTGD VNTGAFIGGN FSNGAFWQSD HQGQWGAHYA      2220
     ITVPQIPLLN FSLNIPVNIP IHLDFGTLAV NGFQIPAITL RALGVTHFSV GPIIVPRIAG      2280
     TLPVIDINIG DPGGSSSIPI TITSGAGPVV IPLLDIPPAP GFGNSTTGPS SGFFNSGTGS      2340
     SSGFGNVGAN NSGFWNTAFA GIGNSGLQNF GSLQSGWANL GNTVSGFYNT SAADFATPAN      2400
     LSGLSNVGAD LTGVLRGPNG STFNAGLANL GQFNVGSANL GSANLGSANL GNSNVGFGNI      2460
     GNANIGGANI GDFNVGIANT GPGLTAAVNN IGIGNTGNYN IGVGNTGNYN IGFGNTGNNN      2520
     IGIGLSGDNQ IGFGPLNAGI ANMGLFNLGD NNFGMANAGN FNQGIANTGN NNIGLFNTGN      2580
     NNVGIGLTGD GLSGFSSLNS GAGNTGFFNS GTANTGLFNS GTGNTGLFNS GTGNVGIGNM      2640
     GTGGFGVGLS GDSQVGIGGT NSGSFNIGLF NSGTGNVGIG NSGTGNVGIG NTGTGNTGIG      2700
     NSGNYNTGLL NAGLVNTGIA NPGNHNTGLF NIGTFNTGIA NPGHYNTGSY NTGSYNTGMA      2760
     NAGDYGTGAF ITGSMNNGLL WRADRQGLLA ANYTITIERP AAFLNVDIPV NIPITGDITN      2820
     VSIPAITFPR IDASGSVDIG ILSGTVLAPV GPITLHGGDA SAPLDTPIEI DFGPSPAINL      2880
     NIGKPDGSTV INIVGGAGAG PISIPIIDLR PAPGFFNATT GPSSGFLNWG AGSASGLLNF      2940
     GNNSGLYNFA TSSMGNSGFQ NYGSLQSGWA NLGNSISGIY NTGLGAPANV SGLLNIGTNL      3000
     AGWLQNGPTE TTFSVGLANL GFWNLGSANI GNYNLGSANI GVYNLGSANI GDFNLGSANI      3060
     GDFNLGSANI GSSNIGFGNV GPGLTAAIGN IGFGNTGNGN IGIGLTGDTM TGFGGWNSGT      3120
     GNIGLFNSGT GNIGFGNSGT GNWGIGNSGD YNTGIGNTGS TNSGFFNTGL VNTGIGNSGD      3180
     YNTGLFNAGN TNTGSFNPGD YNTGGFNPGN YNTGYFNPGN SNTGIANSGD VNTGAFNSGN      3240
     YSNGFFWRGD YQGLGGFAYQ SAVSEIPWSY DRFQH                                 3275
//

If you have problems or comments...

PBIL Back to PBIL home page