(data stored in ACNUC7421 zone)

EMBL: CP001658.PE376

CP001658.PE376       Location/Qualifiers
FT   CDS             complement(445930..447060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00369"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00369"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23397"
FT                   /protein_id="ACT23397.1"
FT                   /translation="MNLANRAASAETAVTQRHLRRLWALPGTQLAVVAWPSTRRDRLFG
FT                   SWHYWWQAHLLDCLVDAQLRDPQPQRRARINRQVRSHRVRNNFSWLNSYYDDMAWLALA
FT                   LERADRVAGVRRRRALPKLTNQFVEAWVPEDGGGIPWRKQDQFFNAPANGPAGLFLARY
FT                   PDQYGKRLKRAEQMADWIDRTLIDPETHLVFDGIKAGSLVRAQYTYCQGVVLGLETELA
FT                   VRTGPAARARHCARVHRLVAAVNEHMAPLGVLRGAGGGDGGLFAGITARYLALVATTLP
FT                   GDSADDAAARDTARAIVLASAQSAWDYRQTVDGLPVFGAFWDREAELPTAGGEQARSVR
FT                   GAVHSSAIAERDLSVQLSGWMLMEAAHSAAAVSSLG"
     MNLANRAASA ETAVTQRHLR RLWALPGTQL AVVAWPSTRR DRLFGSWHYW WQAHLLDCLV        60
     DAQLRDPQPQ RRARINRQVR SHRVRNNFSW LNSYYDDMAW LALALERADR VAGVRRRRAL       120
     PKLTNQFVEA WVPEDGGGIP WRKQDQFFNA PANGPAGLFL ARYPDQYGKR LKRAEQMADW       180
     IDRTLIDPET HLVFDGIKAG SLVRAQYTYC QGVVLGLETE LAVRTGPAAR ARHCARVHRL       240
     VAAVNEHMAP LGVLRGAGGG DGGLFAGITA RYLALVATTL PGDSADDAAA RDTARAIVLA       300
     SAQSAWDYRQ TVDGLPVFGA FWDREAELPT AGGEQARSVR GAVHSSAIAE RDLSVQLSGW       360
     MLMEAAHSAA AVSSLG                                                       376
//

If you have problems or comments...

PBIL Back to PBIL home page