(data stored in ACNUC7421 zone)

EMBL: CP001658.PE382

CP001658.PE382       Location/Qualifiers
FT   CDS             complement(450903..451496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00375"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00375"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23403"
FT                   /protein_id="ACT23403.1"
FT                   /translation="MTATQITGVVLAAGRSNRLGTPKQLLPYRDTTVLGATLDVARQAG
FT                   FDQLILTLGGAASAVRAAMALDGTDVVVVEDVERGCAASLRVALARVHPRATGIVLMLG
FT                   DQPQVAPATLRRIIDVGPATEIMVCRYADGVGHPFWFSRTVFGELARLHGDKGVWKLVH
FT                   SGRHPVRELAVDGCVPLDVDTWDDYRRLLESVPS"
     MTATQITGVV LAAGRSNRLG TPKQLLPYRD TTVLGATLDV ARQAGFDQLI LTLGGAASAV        60
     RAAMALDGTD VVVVEDVERG CAASLRVALA RVHPRATGIV LMLGDQPQVA PATLRRIIDV       120
     GPATEIMVCR YADGVGHPFW FSRTVFGELA RLHGDKGVWK LVHSGRHPVR ELAVDGCVPL       180
     DVDTWDDYRR LLESVPS                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page