(data stored in ACNUC7421 zone)

EMBL: CP001658.PE385

CP001658.PE385       Location/Qualifiers
FT   CDS             complement(454663..455142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00378"
FT                   /product="carbon monoxyde dehydrogenase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00378"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23406"
FT                   /protein_id="ACT23406.1"
FT                   /translation="MQVNMTVNGEPVTAEVEPRMLLVHFLRDQLRLTGTHWGCDTSNCG
FT                   TCVVEVDGVPVKSCTMLAVMASGHSIRTVEGLAGPDGQLDPVQEGFMRCHGLQCGFCTP
FT                   GMLITARALLDRNPDPDEQTIREAISGQICRCTGYTTIVRSIQWAAAHQTVKAQS"
     MQVNMTVNGE PVTAEVEPRM LLVHFLRDQL RLTGTHWGCD TSNCGTCVVE VDGVPVKSCT        60
     MLAVMASGHS IRTVEGLAGP DGQLDPVQEG FMRCHGLQCG FCTPGMLITA RALLDRNPDP       120
     DEQTIREAIS GQICRCTGYT TIVRSIQWAA AHQTVKAQS                              159
//

If you have problems or comments...

PBIL Back to PBIL home page