(data stored in ACNUC7421 zone)

EMBL: CP001658.PE389

CP001658.PE389       Location/Qualifiers
FT   CDS             complement(457172..458080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00382"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00382"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23410"
FT                   /protein_id="ACT23410.1"
FT                   /translation="MRILVAWATCGAVVLSGLTGCSGSSHSGRTYGAQSARTGESLAVL
FT                   GWNMSVSNLRWSGDYVLIDVDASPTDPHAPHAKPEDIRFGLYGALAHPMESAALGSCGD
FT                   AMAHVRDVVSPLSAPAGRLTGTVCLGPLKERSAVRGVYTYSPRDRIPGTAAAYPAAFPV
FT                   GMLPTNQNDAGLVVKTTSVSAWRADGMQLGKPQLGDPVAFTGNGYMLLGLEVDAVPDRY
FT                   RDDSAARGGPMMLLAAPTLPGRGLSPACATYGSSVLILPDALLDAVHISASLCTQGEIN
FT                   EALLYATVATVGTHAALWTSR"
     MRILVAWATC GAVVLSGLTG CSGSSHSGRT YGAQSARTGE SLAVLGWNMS VSNLRWSGDY        60
     VLIDVDASPT DPHAPHAKPE DIRFGLYGAL AHPMESAALG SCGDAMAHVR DVVSPLSAPA       120
     GRLTGTVCLG PLKERSAVRG VYTYSPRDRI PGTAAAYPAA FPVGMLPTNQ NDAGLVVKTT       180
     SVSAWRADGM QLGKPQLGDP VAFTGNGYML LGLEVDAVPD RYRDDSAARG GPMMLLAAPT       240
     LPGRGLSPAC ATYGSSVLIL PDALLDAVHI SASLCTQGEI NEALLYATVA TVGTHAALWT       300
     SR                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page