(data stored in ACNUC7421 zone)

EMBL: CP001658.PE39

CP001658.PE39        Location/Qualifiers
FT   CDS             complement(42107..42454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00038"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00038"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23060"
FT                   /protein_id="ACT23060.1"
FT                   /translation="MFLAGVLCMCAAAASALFGSWSLCHTPTADPTALALRAMAPTQLA
FT                   AAVMLAAGGVVAVAAPGHTALMVVIVCIAGAVGTLAAGSWQSAQYALRRETASPTANCV
FT                   GSCAVCTQACH"
     MFLAGVLCMC AAAASALFGS WSLCHTPTAD PTALALRAMA PTQLAAAVML AAGGVVAVAA        60
     PGHTALMVVI VCIAGAVGTL AAGSWQSAQY ALRRETASPT ANCVGSCAVC TQACH            115
//

If you have problems or comments...

PBIL Back to PBIL home page